Mouse anti-Human, Mouse ASAHL Monoclonal Antibody | anti-ASAHL antibody

ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT) APC

Cat. Num. AAA6135386

• Gene Names: NAAA; PLT; ASAHL
• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ASAHL; Monoclonal Antibody; ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase; Acid Ceramidase-like Protein; N-acylsphingosine Amidohydrolase-like; ASAH-like Protein; NAAA; PLT) APC; anti-ASAHL antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5E3
• Specificity: Recognizes human ASAHL. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-ASAHL antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa36-105 from human ASAHL (NP_055250) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB)

(ASAHL monoclonal antibody. Western Blot analysis of ASAHL expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ASAHL on NIH/3T3 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ASAHL is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ASAHL antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 109148550
• NCBI GeneID: 27163
• NCBI Accession #: NP_055250
• NCBI GenBank Nucleotide #: NM_014435
• UniProt Accession #: Q02083
• Molecular Weight: 37kDa
• NCBI Official Full Name: N-acylethanolamine-hydrolyzing acid amidase isoform 1
• NCBI Official Synonym Full Names: N-acylethanolamine acid amidase
• NCBI Official Symbol: NAAA
• NCBI Official Synonym Symbols: PLT; ASAHL
• NCBI Protein Information: N-acylethanolamine-hydrolyzing acid amidase
• UniProt Protein Name: N-acylethanolamine-hydrolyzing acid amidase
• UniProt Gene Name: NAAA
• UniProt Synonym Gene Names: ASAHL; PLT; ASAH-like protein
• UniProt Entry Name: NAAA_HUMAN

NCBI Description

This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ASAHL: Degrades bioactive fatty acid amides to their corresponding acids, with the following preference: N- palmitoylethanolamine > N-myristoylethanolamine > N- lauroylethanolamine = N-stearoylethanolamine > N- arachidonoylethanolamine > N-oleoylethanolamine. Also exhibits weak hydrolytic activity against the ceramides N- lauroylsphingosine and N-palmitoylsphingosine. Belongs to the acid ceramidase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.1.-; Hydrolase

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: lysosome; cytoplasm

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; transcription factor binding

Biological Process: lipid metabolic process