Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate (22 KDa).Lane 2: Non-transfected lysate.)

Mouse NAAA Monoclonal Antibody | anti-NAAA antibody

NAAA (N-acylethanolamine Acid amidase, ASAHL, PLT) (HRP)

Gene Names
NAAA; PLT; ASAHL
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
NAAA; Monoclonal Antibody; NAAA (N-acylethanolamine Acid amidase; ASAHL; PLT) (HRP); N-acylethanolamine Acid amidase; PLT; anti-NAAA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F4
Specificity
Recognizes NAAA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NAAA antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NAaa(NP_055250, 36aa-104aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate (22 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate (22 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NAAA transfected lysate using anti-NAAA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAAA MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NAAA transfected lysate using anti-NAAA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAAA MaxPab rabbit polyclonal antibody.)
Product Categories/Family for anti-NAAA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
N-acylethanolamine-hydrolyzing acid amidase isoform 1
NCBI Official Synonym Full Names
N-acylethanolamine acid amidase
NCBI Official Symbol
NAAA
NCBI Official Synonym Symbols
PLT; ASAHL
NCBI Protein Information
N-acylethanolamine-hydrolyzing acid amidase
UniProt Protein Name
N-acylethanolamine-hydrolyzing acid amidase
UniProt Gene Name
NAAA
UniProt Synonym Gene Names
ASAHL; PLT; ASAH-like protein
UniProt Entry Name
NAAA_HUMAN

NCBI Description

This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ASAHL: Degrades bioactive fatty acid amides to their corresponding acids, with the following preference: N- palmitoylethanolamine > N-myristoylethanolamine > N- lauroylethanolamine = N-stearoylethanolamine > N- arachidonoylethanolamine > N-oleoylethanolamine. Also exhibits weak hydrolytic activity against the ceramides N- lauroylsphingosine and N-palmitoylsphingosine. Belongs to the acid ceramidase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.1.-; Hydrolase

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: lysosome; cytoplasm

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; transcription factor binding

Biological Process: lipid metabolic process

Research Articles on NAAA

Similar Products

Product Notes

The NAAA naaa (Catalog #AAA6182777) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NAAA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAAA naaa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAAA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.