<
Western Blot (WB)
(Western Blot detection against Immunogen (33.7kD).)
Mouse anti-Human, Mouse ASAHL Monoclonal Antibody
ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)
Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ASAHL; Monoclonal Antibody; ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase; Acid Ceramidase-like Protein; N-acylsphingosine Amidohydrolase-like; ASAH-like Protein; NAAA; PLT); Anti -ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase; anti-ASAHL antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E3
Specificity
Recognizes human ASAHL. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD*
Applicable Applications for anti-ASAHL antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Western Blot and Immunofluorescence.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa36-105 from human ASAHL (NP_055250) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (33.7kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (33.7kD).)
Western Blot (WB)
(ASAHL monoclonal antibody. Western Blot analysis of ASAHL expression in NIH/3T3.)
Western Blot (WB)
(ASAHL monoclonal antibody. Western Blot analysis of ASAHL expression in NIH/3T3.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to ASAHL on NIH/3T3 cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to ASAHL on NIH/3T3 cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged ASAHL is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ASAHL is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ASAHL antibody
This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ASAHL antibody
Similar Products
Product Notes
The ASAHL (Catalog #AAA644474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ASAHL can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in ELISA, Western Blot and Immunofluorescence. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ASAHL for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FNVSLDSVPE LRWLPVLRHY DLDLVRAAMA QVIGDRVPKW VHVLIGKVVL ELERFLPQPF TGEIRGMCD*. It is sometimes possible for the material contained within the vial of "ASAHL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
