Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AKAP5 Monoclonal Antibody | anti-AKAP5 antibody

AKAP5 (AKAP79, A-kinase Anchor Protein 5, AKAP-5, A-kinase Anchor Protein 79kD, AKAP 79, H21, cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein) (MaxLight 550)

Gene Names
AKAP5; H21; AKAP75; AKAP79
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP5; Monoclonal Antibody; AKAP5 (AKAP79; A-kinase Anchor Protein 5; AKAP-5; A-kinase Anchor Protein 79kD; AKAP 79; H21; cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein) (MaxLight 550); anti-AKAP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A9
Specificity
Recognizes human AKAP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-AKAP5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa334-427 from AKAP5 (NP_004848) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AKAP5 antibody
May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade.
Product Categories/Family for anti-AKAP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
A-kinase anchor protein 5
NCBI Official Synonym Full Names
A-kinase anchoring protein 5
NCBI Official Symbol
AKAP5
NCBI Official Synonym Symbols
H21; AKAP75; AKAP79
NCBI Protein Information
A-kinase anchor protein 5
UniProt Protein Name
A-kinase anchor protein 5
Protein Family
UniProt Gene Name
AKAP5
UniProt Synonym Gene Names
AKAP79; AKAP-5; AKAP 79
UniProt Entry Name
AKAP5_HUMAN

NCBI Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq, Jul 2008]

Uniprot Description

AKAP5: May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade. Binding protein for dimer of the RII-beta regulatory subunit of cAMP-dependent protein kinase (PKA) and also for the protein kinase C (PKC) and the phosphatase calcineurin (PP2B). Each enzyme is inhibited when bound to the anchoring protein. Also binds the beta2-adrenergic receptor. Part of a complex containing AKAP5, ADCY5, ADCY6 AND PDE4C. Interacts with ADCY8, and enhances its phosphorylation at lipid rafts. Predominantly in the cerebral cortex and the postsynaptic densities of the forebrain, and to a lesser extent in adrenal medulla, lung and anterior pituitary.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.3

Cellular Component: plasma membrane; cytosol

Molecular Function: calmodulin binding; protein binding; protein kinase A binding; adenylate cyclase binding

Biological Process: synaptic transmission; positive regulation of cAMP biosynthetic process; energy reserve metabolic process; signal transduction; regulation of insulin secretion; protein targeting

Research Articles on AKAP5

Similar Products

Product Notes

The AKAP5 akap5 (Catalog #AAA6210145) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP5 (AKAP79, A-kinase Anchor Protein 5, AKAP-5, A-kinase Anchor Protein 79kD, AKAP 79, H21, cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP5 akap5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.