Western Blot (WB)
(Western Blot detection against Immunogen (33.99kD).)
Mouse anti-Human COX6C Monoclonal Antibody | anti-COX6C antibody
COX6C (Cytochrome C Oxidase 6c, Cytochrome C Oxidase Polypeptide VIc, Cytochrome C Oxidase Subunit VIc) APC
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COX6C; Monoclonal Antibody; COX6C (Cytochrome C Oxidase 6c; Cytochrome C Oxidase Polypeptide VIc; Cytochrome C Oxidase Subunit VIc) APC; anti-COX6C antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G4-2A8
Specificity
Recognizes human COX6C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
416
Applicable Applications for anti-COX6C antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-75 from human COX6C (AAH00187) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (33.99kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (33.99kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-COX6C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens cytochrome c oxidase subunit VIc, mRNA
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 6C
NCBI Official Symbol
COX6C
NCBI Protein Information
cytochrome c oxidase subunit 6C
Protein Family
NCBI Description
Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010]
Research Articles on COX6C
Similar Products
Product Notes
The COX6C (Catalog #AAA6136025) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COX6C (Cytochrome C Oxidase 6c, Cytochrome C Oxidase Polypeptide VIc, Cytochrome C Oxidase Subunit VIc) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COX6C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COX6C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COX6C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
