Mouse anti-Human A2M Monoclonal Antibody | anti-A2M antibody

A2M (Alpha-2-macroglobulin, Alpha-2-M, CPAMD5, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5, FWP007) (PE)

Cat. Num. AAA6156313

• Gene Names: A2M; A2MD; CPAMD5; FWP007; S863-7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: A2M; Monoclonal Antibody; A2M (Alpha-2-macroglobulin; Alpha-2-M; CPAMD5; C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5; FWP007) (PE); anti-A2M antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B5
• Specificity: Recognizes human A2M.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-A2M antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa641-730 from human A2M (NP_000005) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD))

Testing Data

(Detection limit for recombinant GST tagged A2M is 3ng/ml as a capture antibody)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1B and A2M. HeLa cells were stained with IL1B rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-A2M antibody

a2-Macroglobulin (a2M), is a 720kD homotetrameric glycoprotein composed of four identical 180kD subunit. a2M shares with other a-macroglobulins, like the complement components C3 and C4 and the pregnancy zone protein PZP, an extraordinary binding capacity for a variety of ligands. This allows the a-macroglobulins to serve as humoral defense barriers against foreign peptides in the plasma. a2M interacts and captures virtually any proteinase, often referred to as a panprotease inhibitor. In the brain of Alzheimer's disease (AD) patients, a2M also has been localized to diffuse amyloid plaques, supporting an important role for a2M in AD etiopathology.

Product Categories/Family for anti-A2M antibody

Antibodies; Serum Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 66932947
• NCBI GeneID: 2
• NCBI Accession #: NP_000005
• NCBI GenBank Nucleotide #: NM_000014
• UniProt Accession #: P01023; Q13677; Q59F47; Q5QTS0; Q68DN2; Q6PIY3; Q6PN97
• Molecular Weight: 163,291 Da
• NCBI Official Full Name: alpha-2-macroglobulin
• NCBI Official Synonym Full Names: alpha-2-macroglobulin
• NCBI Official Symbol: A2M
• NCBI Official Synonym Symbols: A2MD; CPAMD5; FWP007; S863-7
• NCBI Protein Information: alpha-2-macroglobulin; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; alpha-2-M
• UniProt Protein Name: Alpha-2-macroglobulin
• Protein Family: Alpha-2-macroglobulin
• UniProt Gene Name: A2M
• UniProt Synonym Gene Names: CPAMD5; Alpha-2-M
• UniProt Entry Name: A2MG_HUMAN

Uniprot Description

A2M: Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: extracellular region; cytosol

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; enzyme binding; protease binding; growth factor binding; interleukin-1 binding; interleukin-8 binding; calcium-dependent protein binding; tumor necrosis factor binding; receptor binding

Biological Process: negative regulation of complement activation, lectin pathway; platelet activation; extracellular matrix disassembly; regulation of small GTPase mediated signal transduction; extracellular matrix organization and biogenesis; platelet degranulation; small GTPase mediated signal transduction; stem cell differentiation; blood coagulation; blood coagulation, intrinsic pathway

Disease: Alzheimer Disease; Alpha-2-macroglobulin Deficiency