Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD))

Mouse anti-Human A2M Monoclonal Antibody | anti-A2M antibody

A2M (Alpha-2-macroglobulin, Alpha-2-M, CPAMD5, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5, FWP007) APC

Gene Names
A2M; A2MD; CPAMD5; FWP007; S863-7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
A2M; Monoclonal Antibody; A2M (Alpha-2-macroglobulin; Alpha-2-M; CPAMD5; C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5; FWP007) APC; anti-A2M antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human A2M.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-A2M antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa641-730 from human A2M (NP_000005) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD))

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD))

Testing Data

(Detection limit for recombinant GST tagged A2M is 3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged A2M is 3ng/ml as a capture antibody)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1B and A2M. HeLa cells were stained with IL1B rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1B and A2M. HeLa cells were stained with IL1B rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-A2M antibody
a2-Macroglobulin (a2M), is a 720kD homotetrameric glycoprotein composed of four identical 180kD subunit. a2M shares with other a-macroglobulins, like the complement components C3 and C4 and the pregnancy zone protein PZP, an extraordinary binding capacity for a variety of ligands. This allows the a-macroglobulins to serve as humoral defense barriers against foreign peptides in the plasma. a2M interacts and captures virtually any proteinase, often referred to as a panprotease inhibitor. In the brain of Alzheimer's disease (AD) patients, a2M also has been localized to diffuse amyloid plaques, supporting an important role for a2M in AD etiopathology.
Product Categories/Family for anti-A2M antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
2
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
163,291 Da
NCBI Official Full Name
alpha-2-macroglobulin
NCBI Official Synonym Full Names
alpha-2-macroglobulin
NCBI Official Symbol
A2M
NCBI Official Synonym Symbols
A2MD; CPAMD5; FWP007; S863-7
NCBI Protein Information
alpha-2-macroglobulin; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; alpha-2-M
UniProt Protein Name
Alpha-2-macroglobulin
Protein Family
UniProt Gene Name
A2M
UniProt Synonym Gene Names
CPAMD5; Alpha-2-M
UniProt Entry Name
A2MG_HUMAN

Uniprot Description

A2M: Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: extracellular region; cytosol

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; enzyme binding; protease binding; growth factor binding; interleukin-1 binding; interleukin-8 binding; calcium-dependent protein binding; tumor necrosis factor binding; receptor binding

Biological Process: negative regulation of complement activation, lectin pathway; platelet activation; extracellular matrix disassembly; regulation of small GTPase mediated signal transduction; extracellular matrix organization and biogenesis; platelet degranulation; small GTPase mediated signal transduction; stem cell differentiation; blood coagulation; blood coagulation, intrinsic pathway

Disease: Alzheimer Disease; Alpha-2-macroglobulin Deficiency

Similar Products

Product Notes

The A2M a2m (Catalog #AAA6135101) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The A2M (Alpha-2-macroglobulin, Alpha-2-M, CPAMD5, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5, FWP007) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A2M can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the A2M a2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "A2M, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.