Mannose-binding protein C (Mbl2) Recombinant Protein | Mbl2 recombinant protein

Recombinant Mouse Mannose-binding protein C (Mbl2)

Cat. Num. AAA953086

• Gene Names: Mbl2; MBL; L-MBP; MBL-C; MBP-C
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mannose-binding protein C (Mbl2); Recombinant Mouse Mannose-binding protein C (Mbl2); Mbl2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-244, Full length protein
• Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
• Sequence Length: 226

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Mbl2 recombinant protein

This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

NCBI and Uniprot Product Information

• NCBI GI #: 6754656
• NCBI GeneID: 17195
• NCBI Accession #: NP_034906.1
• NCBI GenBank Nucleotide #: NM_010776.1
• UniProt Accession #: P41317
• Molecular Weight: 25,957 Da
• NCBI Official Full Name: mannose-binding protein C
• NCBI Official Synonym Full Names: mannose-binding lectin (protein C) 2
• NCBI Official Symbol: Mbl2
• NCBI Official Synonym Symbols: MBL; L-MBP; MBL-C; MBP-C
• NCBI Protein Information: mannose-binding protein C
• UniProt Protein Name: Mannose-binding protein C
• Protein Family: Mannose-binding protein
• UniProt Gene Name: Mbl2
• UniProt Synonym Gene Names: MBP-C; RARF/P28A

Uniprot Description

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages ().