Interleukin-17A (Il17a) Active Protein | Il17a active protein

Recombinant Mouse Interleukin-17A (Il17a), Partial

Cat. Num. AAA7115075

• Gene Names: Il17a; Il17; Ctla8; IL-17; Ctla-8; IL-17A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-17A (Il17a); Recombinant Mouse Interleukin-17A (Il17a); Partial; Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17; Il17a active protein

• Host: Mammalian Cell
• Specificity: Restricted to a subset of activated T-cells.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 22-158aa; Partial
• Sequence: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Sequence Length: 158

• Species: Mouse
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells is less than 200 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-17 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Il17a active protein

Relevance: Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Mature mouse IL-17A shares 61% and 89% amino acid sequence identity with human and rat IL-17A, respectively. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Function: Ligand for IL17RA.

Product Categories/Family for Il17a active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 6754324
• NCBI GeneID: 16171
• NCBI Accession #: NP_034682.1
• NCBI GenBank Nucleotide #: NM_010552.3
• UniProt Accession #: Q62386
• Molecular Weight: 16.2 kDa
• NCBI Official Full Name: interleukin-17A
• NCBI Official Synonym Full Names: interleukin 17A
• NCBI Official Symbol: Il17a
• NCBI Official Synonym Symbols: Il17; Ctla8; IL-17; Ctla-8; IL-17A
• NCBI Protein Information: interleukin-17A
• UniProt Protein Name: Interleukin-17A
• Protein Family: Interleukin
• UniProt Gene Name: Il17a
• UniProt Synonym Gene Names: Ctla8; Il17; IL-17; IL-17A; CTLA-8
• UniProt Entry Name: IL17_MOUSE

NCBI Description

This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Sep 2015]

Uniprot Description

IL17A: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts. Belongs to the IL-17 family.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: cytokine activity

Biological Process: positive regulation of osteoclast differentiation; positive regulation of interleukin-23 production; positive regulation of transcription from RNA polymerase II promoter; inflammatory response