Leukocyte immunoglobulin-like receptor subfamily B member 4 (Lilrb4) Recombinant Protein | Lilrb4 recombinant protein

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 4 (Lilrb4), partial

Cat. Num. AAA1388944

• Gene Names: Lilrb4a; HM18; ILT3; gp49; CD85K; Gp49b; LIR-5; Lilrb4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Leukocyte immunoglobulin-like receptor subfamily B member 4 (Lilrb4); Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 4 (Lilrb4); partial; Lilrb4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-238; Partial?Provide the complete extracellular domain.
• Sequence: GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
• Sequence Length: 238

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Lilrb4 recombinant protein

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. The receptor can also function in antigen capture and presentation. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 7305097
• NCBI GeneID: 14728
• NCBI Accession #: NP_038560.1
• NCBI GenBank Nucleotide #: NM_013532.3
• UniProt Accession #: Q64281; Q64312
• Molecular Weight: 33,049 Da
• NCBI Official Full Name: leukocyte immunoglobulin-like receptor subfamily B member 4 isoform 1
• NCBI Official Synonym Full Names: leukocyte immunoglobulin-like receptor, subfamily B, member 4A
• NCBI Official Symbol: Lilrb4a
• NCBI Official Synonym Symbols: HM18; ILT3; gp49; CD85K; Gp49b; LIR-5; Lilrb4
• NCBI Protein Information: leukocyte immunoglobulin-like receptor subfamily B member 4
• UniProt Protein Name: Leukocyte immunoglobulin-like receptor subfamily B member 4
• Protein Family: Leukocyte immunoglobulin-like receptor subfamily
• UniProt Gene Name: Lilrb4
• UniProt Synonym Gene Names: Gp49b

Uniprot Description

Receptor for class I MHC antigens. Involved in the down-regulation of the immune response and the development of tolerance. Interferes with TNFRSF5-signaling and NF-kappa-B up-regulation. Inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions ().