Lysosome-associated membrane glycoprotein 1 (Lamp1) Recombinant Protein | Lamp1 recombinant protein
Recombinant Rat Lysosome-associated membrane glycoprotein 1 (Lamp1)
Gene Names
Lamp1; LGP120
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysosome-associated membrane glycoprotein 1 (Lamp1); Recombinant Rat Lysosome-associated membrane glycoprotein 1 (Lamp1); Recombinant Lysosome-associated membrane glycoprotein 1 (Lamp1); Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; LGP-120 CD107 antigen-like family member A CD_antigen= C; Lamp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-407
Sequence
APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Sequence Length
407
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,969 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 1
NCBI Official Synonym Full Names
lysosomal-associated membrane protein 1
NCBI Official Symbol
Lamp1
NCBI Official Synonym Symbols
LGP120
NCBI Protein Information
lysosome-associated membrane glycoprotein 1; LAMP-1; LGP-120; lysosomal membrane glycoprotein 1; CD107 antigen-like family member A; lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; Lysosomal associated membrane protein 1 (120 kDa)
UniProt Protein Name
Lysosome-associated membrane glycoprotein 1
Protein Family
UniProt Gene Name
Lamp1
UniProt Synonym Gene Names
Lamp-1; LAMP-1; Lysosome-associated membrane protein 1; LGP-120
UniProt Entry Name
LAMP1_RAT
NCBI Description
a lysosomal acidic membrane protein [RGD, Feb 2006]
Uniprot Description
LAMP1: Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis. Belongs to the LAMP family.
Protein type: Membrane protein, integral
Similar Products
Product Notes
The Lamp1 lamp1 (Catalog #AAA956359) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-407. The amino acid sequence is listed below: APALFEVKDN NGTACIMASF SASFLTTYDA GHVSKVSNMT LPASAEVLKN SSSCGEKNAS EPTLAITFGE GYLLKLTFTK NTTRYSVQHM YFTYNLSDTQ FFPNASSKGP DTVDSTTDIK ADINKTYRCV SDIRVYMKNV TIVLWDATIQ AYLPSSNFSK EETRCPQDQP SPTTGPPSPS PPLVPTNPSV SKYNVTGDNG TCLLASMALQ LNITYMKKDN TTVTRAFNIN PSDKYSGTCG AQLVTLKVGN KSRVLELQFG MNATSSLFFL QGVQLNMTLP DAIEPTFSTS NYSLKALQAS VGNSYKCNSE EHIFVSKALA LNVFSVQVQA FRVESDRFGS VEECVQDGNN MLIPIAVGGA LAGLVLIVLI AYLIGRKRSH AGYQTI. It is sometimes possible for the material contained within the vial of "Lysosome-associated membrane glycoprotein 1 (Lamp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
