Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lysine-specific demethylase 5A (Kdm5a) Recombinant Protein | Kdm5a recombinant protein

Recombinant Mouse Lysine-specific demethylase 5A (Kdm5a) , partial

Gene Names
Kdm5a; RBP2; Rbbp2; C76986; Jarid1a; AA409370
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysine-specific demethylase 5A (Kdm5a); Recombinant Mouse Lysine-specific demethylase 5A (Kdm5a); partial; Kdm5a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
437-603. Partial
Sequence
EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYR
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Kdm5a recombinant protein
This protein is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
192,216 Da
NCBI Official Full Name
lysine-specific demethylase 5A
NCBI Official Synonym Full Names
lysine (K)-specific demethylase 5A
NCBI Official Symbol
Kdm5a
NCBI Official Synonym Symbols
RBP2; Rbbp2; C76986; Jarid1a; AA409370
NCBI Protein Information
lysine-specific demethylase 5A
UniProt Protein Name
Lysine-specific demethylase 5A
UniProt Gene Name
Kdm5a
UniProt Synonym Gene Names
Jarid1a; Rbp2; RBBP-2

Uniprot Description

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4' (PubMed:17320161, PubMed:17320163). Regulates specific gene transcription through DNA-binding on 5'-CCGCCC-3' motif. May stimulate transcription mediated by nuclear receptors. Involved in transcriptional regulation of Hox proteins during cell differentiation (). May participate in transcriptional repression of cytokines such as CXCL12. Plays a role in the regulation of the circadian rhythm and in maintaining the normal periodicity of the circadian clock. In a histone demethylase-independent manner, acts as a coactivator of the CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2 and other clock-controlled genes and increases histone acetylation at PER1/2 promoters by inhibiting the activity of HDAC1 (PubMed:21960634). Seems to act as a transcriptional corepressor for some genes such as MT1F and to favor the proliferation of cancer cells ().

Research Articles on Kdm5a

Similar Products

Product Notes

The Kdm5a kdm5a (Catalog #AAA1469524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 437-603. Partial. The amino acid sequence is listed below: EYALSGWNLN NMPVLEQSVL AHINVDISGM KVPWLYVGMC FSSFCWHIED HWSYSINYLH WGEPKTWYGV PSHAAEQLEE VMRELAPELF ESQPDLLHQL VTIMNPNVLM EHGVPVYRTN QCAGEFVVTF PRAYHSGFNQ GYNFAEAVNF CTADWLPIGR QCVNHYR . It is sometimes possible for the material contained within the vial of "Lysine-specific demethylase 5A (Kdm5a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.