Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DLX3 rabbit polyclonal antibody. Western Blot analysis of DLX3 expression in mouse brain.)

Rabbit anti-Human, Mouse DLX3 Polyclonal Antibody | anti-DLX3 antibody

DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP)

Gene Names
DLX3; AI4; TDO
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX3; Polyclonal Antibody; DLX3 (Distal-less Homeobox 3; DLX 3; AI4; Homeobox Protein DLX 3; TDO) (AP); anti-DLX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DLX3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DLX3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DLX3, aa1-287 (NP_005211.1).
Immunogen Sequence
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DLX3 rabbit polyclonal antibody. Western Blot analysis of DLX3 expression in mouse brain.)

Western Blot (WB) (DLX3 rabbit polyclonal antibody. Western Blot analysis of DLX3 expression in mouse brain.)

Western Blot (WB)

(Western Blot analysis of DLX3 expression in transfected 293T cell line by DLX3 polyclonal antibody. Lane 1: DLX3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DLX3 expression in transfected 293T cell line by DLX3 polyclonal antibody. Lane 1: DLX3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DLX3 antibody
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.
Product Categories/Family for anti-DLX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,738 Da
NCBI Official Full Name
homeobox protein DLX-3
NCBI Official Synonym Full Names
distal-less homeobox 3
NCBI Official Symbol
DLX3
NCBI Official Synonym Symbols
AI4; TDO
NCBI Protein Information
homeobox protein DLX-3
UniProt Protein Name
Homeobox protein DLX-3
Protein Family
UniProt Gene Name
DLX3
UniProt Entry Name
DLX3_HUMAN

NCBI Description

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq, Jul 2008]

Uniprot Description

DLX3: Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis. Defects in DLX3 are a cause of trichodentoosseous syndrome (TDO). TDO is an autosomal dominant syndrome characterized by enamel hypoplasia and hypocalcification with associated strikingly curly hair. Defects in DLX3 are the cause of amelogenesis imperfecta type 4 (AI4); also known as amelogenesis imperfecta hypomaturation-hypoplastic type with taurodontism. AI4 is an autosomal dominant defect of enamel formation associated with enlarged pulp chambers. Belongs to the distal-less homeobox family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: blood vessel development; positive regulation of transcription from RNA polymerase II promoter; placenta development; odontogenesis of dentine-containing teeth

Disease: Amelogenesis Imperfecta, Type Iv; Trichodentoosseous Syndrome

Research Articles on DLX3

Similar Products

Product Notes

The DLX3 dlx3 (Catalog #AAA6376326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DLX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX3 dlx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.