Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Anti-TFF1/PS2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.)

Mouse anti-Human TFF1/pS2 Monoclonal Antibody | anti-TFF1/pS2 antibody

Anti-TFF1/pS2 Antibody (aa54-84, clone pS2.1)

Gene Names
TFF1; pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21
Reactivity
Human
Applications
Immunohistochemistry
Purity
Protein G purified
Synonyms
TFF1/pS2; Monoclonal Antibody; Anti-TFF1/pS2 Antibody (aa54-84; clone pS2.1); Mouse Monoclonal [clone pS2.1] (IgG1) to Human TFF1/pS2; TFF1; BCEI; D21S21; HPS2; PNR-2; Polypeptide P1.A; Protein pS2; PS2; HP1.A; Trefoil factor 1; anti-TFF1/pS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
pS2.1
Purity/Purification
Protein G purified
Form/Format
10mM PBS, pH 7.4, with 0.2% BSA and 0.09% Sodium Azide
Sequence Length
84
Applicable Applications for anti-TFF1/pS2 antibody
Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 10 ug/ml
Immunogen
A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein. Percent identity by BLAST analysis: Human (100%); Monkey (87%).
Conjugation
Unconjugated
Epitope
aa54-84
Preparation and Storage
Stable for 24 months when stored at 2-8 degree C.

Immunohistochemistry (IHC)

(Anti-TFF1/PS2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.)

Immunohistochemistry (IHC) (Anti-TFF1/PS2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.)
Related Product Information for anti-TFF1/pS2 antibody
trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserveddisulfides. they are stable secretory proteins expressed ingastrointestinal mucosa. their functions are not defined, but they mayprotect the mucosa from insults, stabilize the mucus layer and affecthealing of the epithelium. TFF1, which is expressed in the gastricmucosa, has also been studied because of its expression in human tumors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,150 Da
NCBI Official Full Name
trefoil factor 1
NCBI Official Synonym Full Names
trefoil factor 1
NCBI Official Symbol
TFF1
NCBI Official Synonym Symbols
pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21
NCBI Protein Information
trefoil factor 1
UniProt Protein Name
Trefoil factor 1
UniProt Gene Name
TFF1
UniProt Synonym Gene Names
BCEI; PS2; hP1.A

NCBI Description

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

Uniprot Description

Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.

Research Articles on TFF1/pS2

Similar Products

Product Notes

The TFF1/pS2 tff1 (Catalog #AAA2400857) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-TFF1/pS2 Antibody (aa54-84, clone pS2.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFF1/pS2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC) Paraffin. IHC-P: 10 ug/ml. Researchers should empirically determine the suitability of the TFF1/pS2 tff1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFF1/pS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.