Potassium channel subfamily K member 2 Recombinant Protein | KCNK2 recombinant protein

Recombinant Human Potassium channel subfamily K member 2

Cat. Num. AAA1249196

• Gene Names: KCNK2; TREK; TPKC1; TREK1; K2p2.1; TREK-1; hTREK-1c; hTREK-1e
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium channel subfamily K member 2; Recombinant Human Potassium channel subfamily K member 2; Outward rectifying potassium channel protein TREK-1; TREK-1 K(+) channel subunit; Two pore domain potassium channel TREK-1; Two pore potassium channel TPKC1; KCNK2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-143
• Sequence: MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD
• Sequence Length: 422

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for KCNK2 recombinant protein

Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1

Product Categories/Family for KCNK2 recombinant protein

Neuroscience

References

"Cloning, localisation and functional expression of the human orthologue of the TREK-1 potassium channel." Meadows H.J., Benham C.D., Cairns W., Gloger I., Jennings C., Medhurst A.D., Murdock P., Chapman C.G. Pflugers Arch. 439:714-722(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 62912487
• NCBI GeneID: 3776
• NCBI Accession #: NP_001017424.1
• NCBI GenBank Nucleotide #: NM_001017424.2
• UniProt Accession #: O95069; Q5DP47; Q5DP48; Q9NRT2; Q9UNE3; A1Z1V3; A8K618; B2RCS4; B7ZL56; D3DTA5
• Molecular Weight: 17.7 kDa
• NCBI Official Full Name: potassium channel subfamily K member 2 isoform a
• NCBI Official Synonym Full Names: potassium two pore domain channel subfamily K member 2
• NCBI Official Symbol: KCNK2
• NCBI Official Synonym Symbols: TREK; TPKC1; TREK1; K2p2.1; TREK-1; hTREK-1c; hTREK-1e
• NCBI Protein Information: potassium channel subfamily K member 2
• UniProt Protein Name: Potassium channel subfamily K member 2
• Protein Family: Potassium channel subfamily
• UniProt Gene Name: KCNK2
• UniProt Synonym Gene Names: TREK; TREK1
• UniProt Entry Name: KCNK2_HUMAN

NCBI Description

This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane potential. The channel can be opened, however, by certain anesthetics, membrane stretching, intracellular acidosis, and heat. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 ().