Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intraflagellar transport protein 43 homolog (IFT43) Recombinant Protein | IFT43 recombinant protein

Recombinant Human Intraflagellar transport protein 43 homolog (IFT43)

Gene Names
IFT43; CED3; RP81; SRTD18; C14orf179
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intraflagellar transport protein 43 homolog (IFT43); Recombinant Human Intraflagellar transport protein 43 homolog (IFT43); IFT43 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208, Full length protein
Sequence
MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASKFRRKASEEIEDFRLRPQSLNGSDYGGDIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Sequence Length
208
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,521 Da
NCBI Official Full Name
intraflagellar transport protein 43 homolog isoform 2
NCBI Official Synonym Full Names
intraflagellar transport 43
NCBI Official Symbol
IFT43
NCBI Official Synonym Symbols
CED3; RP81; SRTD18; C14orf179
NCBI Protein Information
intraflagellar transport protein 43 homolog
UniProt Protein Name
Intraflagellar transport protein 43 homolog
UniProt Gene Name
IFT43
UniProt Synonym Gene Names
C14orf179

NCBI Description

This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

Component of IFT complex A (IFT-A) involved in retrograde ciliary transport along microtubules from the ciliary tip to the base.

Research Articles on IFT43

Similar Products

Product Notes

The IFT43 ift43 (Catalog #AAA1408722) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208, Full length protein. The amino acid sequence is listed below: MEDLLDLDEE LRYSLATSRA KMGRRAQQES AQAENHLNGK NSSLTLTGET SSAKLPRCRQ GGWAGDSVKA SKFRRKASEE IEDFRLRPQS LNGSDYGGDI PIIPDLEEVQ EEDFVLQVAA PPSIQIKRVM TYRDLDNDLM KYSAIQTLDG EIDLKLLTKV LAPEHEVRED DVGWDWDHLF TEVSSEVLTE WDPLQTEKED PAGQARHT. It is sometimes possible for the material contained within the vial of "Intraflagellar transport protein 43 homolog (IFT43), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.