Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (S100A9 rabbit polyclonal antibody. Western Blot analysis of S100A9 expression in human spleen.)

Rabbit anti-Human S100A9 Polyclonal Antibody | anti-S100A9 antibody

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Gene Names
S100A9; MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A9; Polyclonal Antibody; S100A9 (S100 Calcium Binding Protein A9; 60B8AG; Calgranulin B; CAGB; Calprotectin L1H Subunit; CFAG; CGLB; Cystic Fibrosis Antigen; L1AG; Leukocyte L1 Complex Heavy Chain; LIAG; MAC387; Migration Inhibitory Factor-related Protein 14; MIF Related Protein; anti-S100A9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human S100A9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-S100A9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human S100A9, aa1-114 (NP_002956.1).
Immunogen Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(S100A9 rabbit polyclonal antibody. Western Blot analysis of S100A9 expression in human spleen.)

Western Blot (WB) (S100A9 rabbit polyclonal antibody. Western Blot analysis of S100A9 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of S100A9 expression in transfected 293T cell line by S100A9 polyclonal antibody. Lane 1: S100A9 transfected lysate (13.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S100A9 expression in transfected 293T cell line by S100A9 polyclonal antibody. Lane 1: S100A9 transfected lysate (13.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-S100A9 antibody
S100 Calcium Binding Protein A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+-binding proteins. It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis. S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer. This protein may function in the inhibition of casein kinase.
Product Categories/Family for anti-S100A9 antibody
References
1. Restoration of anti-Aspergillus defense by neutrophil extracellular traps in human chronic granulomatous disease after gene therapy is calprotectin-dependent. Bianchi M, Niemiec MJ, Siler U, Urban CF, Reichenbach J.J Allergy Clin Immunol. 2011 Mar 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,242 Da
NCBI Official Full Name
protein S100-A9
NCBI Official Synonym Full Names
S100 calcium binding protein A9
NCBI Official Symbol
S100A9
NCBI Official Synonym Symbols
MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
NCBI Protein Information
protein S100-A9; MRP-14; S100 calcium-binding protein A9 (calgranulin B); calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14
UniProt Protein Name
Protein S100-A9
Protein Family
UniProt Gene Name
S100A9
UniProt Synonym Gene Names
CAGB; CFAG; MRP14; MRP-14; p14
UniProt Entry Name
S10A9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]

Uniprot Description

S100A9: a calcium-binding regulatory protein of the S-100 family expressed by macrophages in acutely inflammated tissues and in chronic inflammations. May be an inhibitor of protein kinases. Also expressed in epithelial cells constitutively or induced during dermatoses. May interact with components of the intermediate filaments in monocytes and epithelial cells. Interacts with CEACAM3 in a calcium-dependent manner.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; cytoskeleton; plasma membrane; extracellular region; cytosol; nucleus

Molecular Function: arachidonic acid binding; antioxidant activity; signal transducer activity; protein binding; RAGE receptor binding; zinc ion binding; microtubule binding; calcium ion binding

Biological Process: caspase activation; neutrophil chemotaxis; chemokine production; chronic inflammatory response; cytokine production; response to lipopolysaccharide; positive regulation of peptide secretion; signal transduction; positive regulation of cell growth; leukocyte migration during inflammatory response; activation of NF-kappaB transcription factor; sequestering of zinc ion; response to ethanol; cell-cell signaling; response to zinc ion; actin cytoskeleton reorganization; defense response to bacterium; autophagy; innate immune response; regulation of integrin biosynthetic process; inflammatory response; defense response to fungus; regulation of cytoskeleton organization and biogenesis; positive regulation of inflammatory response

Research Articles on S100A9

Similar Products

Product Notes

The S100A9 s100a9 (Catalog #AAA6393203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A9 s100a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.