Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TICAM1 blocking peptide

TICAM1 Peptide - C-terminal region

Gene Names
TICAM1; TRIF; IIAE6; MyD88-3; PRVTIRB; TICAM-1
Reactivity
Human
Applications
Western Blot
Synonyms
TICAM1; TICAM1 Peptide - C-terminal region; TICAM1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPE
Sequence Length
712
Applicable Applications for TICAM1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TICAM1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TICAM1 Antibody, made

Target Description: This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response.
Product Categories/Family for TICAM1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78 kDa
NCBI Official Full Name
TIR domain-containing adapter molecule 1
NCBI Official Synonym Full Names
toll like receptor adaptor molecule 1
NCBI Official Symbol
TICAM1
NCBI Official Synonym Symbols
TRIF; IIAE6; MyD88-3; PRVTIRB; TICAM-1
NCBI Protein Information
TIR domain-containing adapter molecule 1
UniProt Protein Name
TIR domain-containing adapter molecule 1
UniProt Gene Name
TICAM1
UniProt Synonym Gene Names
PRVTIRB; TRIF; TICAM-1; MyD88-3
UniProt Entry Name
TCAM1_HUMAN

NCBI Description

This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response. [provided by RefSeq, Jan 2012]

Uniprot Description

TICAM1: an adaptor protein involved in innate immunity against invading pathogens. Associates with TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TICAM1 recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively. Interacts with the TIR domain of TLR3. Interacts with AZI2, TBK1, IRF3 and IRF7. Interacts with TICAM2 in TLR4 recruitment. Interaction with PIAS4 inhibits the TICAM1-induced NF-kappa-B, IRF and IFNB1 activation. Interacts with IKBKB and IKBKE. Interaction with SARM1 blocks TICAM1-dependent transcription factor activation. Interacts with TRAF3. Interacts with TRAFD1.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: endosome membrane; cytosol

Molecular Function: protein binding; signal transducer activity; protein kinase binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of nitric oxide biosynthetic process; positive regulation of protein binding; regulation of protein homodimerization activity; MyD88-independent toll-like receptor signaling pathway; positive regulation of interleukin-6 production; toll-like receptor 3 signaling pathway; positive regulation of tumor necrosis factor production; positive regulation of natural killer cell activation; activation of NF-kappaB transcription factor; positive regulation of chemokine biosynthetic process; response to exogenous dsRNA; positive regulation of protein ubiquitination; macrophage activation during immune response; positive regulation of interferon-beta biosynthetic process; toll-like receptor signaling pathway; positive regulation of B cell proliferation; lipopolysaccharide-mediated signaling pathway; innate immune response; inflammatory response; toll-like receptor 4 signaling pathway; defense response to virus

Disease: Herpes Simplex Encephalitis, Susceptibility To, 4

Research Articles on TICAM1

Similar Products

Product Notes

The TICAM1 ticam1 (Catalog #AAA3245583) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TICAM1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TICAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TICAM1 ticam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFPQSPAFPT ASPAPPQSPG LQPLIIHHAQ MVQLGLNNHM WNQRGSQAPE. It is sometimes possible for the material contained within the vial of "TICAM1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.