Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human NXF3 Monoclonal Antibody | anti-NXF3 antibody

NXF3 (Nuclear RNA Export Factor 3, TAP-like Protein 3, TAPL-3, TAPL3) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NXF3; Monoclonal Antibody; NXF3 (Nuclear RNA Export Factor 3; TAP-like Protein 3; TAPL-3; TAPL3) (FITC); anti-NXF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C7
Specificity
Recognizes human NXF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NXF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human NXF3 (NP_071335) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of NXF3 expression in transfected 293T cell line by NXF3 monoclonal antibody. Lane 1: NXF3 transfected lysate (60.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NXF3 expression in transfected 293T cell line by NXF3 monoclonal antibody. Lane 1: NXF3 transfected lysate (60.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NXF3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NXF3 is 1ng/ml as a capture antibody.)
Related Product Information for anti-NXF3 antibody
May function as a tissue-specific nuclear mRNA export factor.
Product Categories/Family for anti-NXF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,102 Da
NCBI Official Full Name
nuclear RNA export factor 3
NCBI Official Synonym Full Names
nuclear RNA export factor 3
NCBI Official Symbol
NXF3
NCBI Protein Information
nuclear RNA export factor 3; TAPL-3; TAP-like protein 3
UniProt Protein Name
Nuclear RNA export factor 3
Protein Family
UniProt Gene Name
NXF3
UniProt Synonym Gene Names
TAPL3; TAPL-3
UniProt Entry Name
NXF3_HUMAN

NCBI Description

This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus. [provided by RefSeq, Jul 2008]

Uniprot Description

NXF3: May function as a tissue-specific nuclear mRNA export factor. Belongs to the NXF family.

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: nucleoplasm; nuclear RNA export factor complex; cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; nucleotide binding

Biological Process: poly(A)+ mRNA export from nucleus; mRNA export from nucleus

Similar Products

Product Notes

The NXF3 nxf3 (Catalog #AAA6148600) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NXF3 (Nuclear RNA Export Factor 3, TAP-like Protein 3, TAPL-3, TAPL3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NXF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NXF3 nxf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NXF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.