Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNAPIN blocking peptide

SNAPIN Peptide - C-terminal region

Gene Names
SNAPIN; BLOS7; BORCS3; SNAPAP; BLOC1S7
Reactivity
Human
Synonyms
SNAPIN; SNAPIN Peptide - C-terminal region; SNAPIN blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSP
Sequence Length
136
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNAPIN blocking peptide
This is a synthetic peptide designed for use in combination with anti- SNAPIN Antibody, made

Target Description: The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Product Categories/Family for SNAPIN blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Full Name
SNARE-associated protein Snapin
NCBI Official Synonym Full Names
SNAP associated protein
NCBI Official Symbol
SNAPIN
NCBI Official Synonym Symbols
BLOS7; BORCS3; SNAPAP; BLOC1S7
NCBI Protein Information
SNARE-associated protein Snapin
UniProt Protein Name
SNARE-associated protein Snapin
Protein Family
UniProt Gene Name
SNAPIN
UniProt Synonym Gene Names
BLOC1S7; SNAP25BP; SNAPAP; BLOC-1 subunit 7; SNAP-associated protein
UniProt Entry Name
SNAPN_HUMAN

NCBI Description

The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Uniprot Description

SNAPIN: a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. Phosphorylation by PKA modulates its interaction with the SNARE complex.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; synaptic vesicle; transport vesicle; cytoplasmic vesicle membrane; synaptic vesicle membrane; perinuclear region of cytoplasm; nucleolus; synapse; cell junction; secretory granule

Molecular Function: SNARE binding; protein binding

Biological Process: viral reproduction; synaptic vesicle maturation; neurotransmitter secretion; synaptic vesicle transport; synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; synaptic vesicle exocytosis; melanosome organization and biogenesis; regulation of protein binding; anterograde synaptic vesicle transport; endosome to lysosome transport; anterograde axon cargo transport; neurite development

Research Articles on SNAPIN

Similar Products

Product Notes

The SNAPIN snapin (Catalog #AAA3248033) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNAPIN Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLNARRRVVL VNNILQNAQE RLRRLNHSVA KETARRRAML DSGIYPPGSP. It is sometimes possible for the material contained within the vial of "SNAPIN, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.