Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC36A1 blocking peptide

SLC36A1 Peptide - N-terminal region

Gene Names
SLC36A1; Dct1; PAT1; LYAAT1; TRAMD3
Reactivity
Human
Synonyms
SLC36A1; SLC36A1 Peptide - N-terminal region; SLC36A1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: STQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQ
Sequence Length
476
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC36A1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SLC36A1 Antibody, made

Target Description: This gene encodes a member of the eukaryote-specific amino acid/auxin permease (AAAP) 1 transporter family. The encoded protein functions as a proton-dependent, small amino acid transporter. This gene is clustered with related family members on chromosome 5q33.1. Alternative splicing results in multiple transcript variants.
Product Categories/Family for SLC36A1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
proton-coupled amino acid transporter 1 isoform a
NCBI Official Synonym Full Names
solute carrier family 36 member 1
NCBI Official Symbol
SLC36A1
NCBI Official Synonym Symbols
Dct1; PAT1; LYAAT1; TRAMD3
NCBI Protein Information
proton-coupled amino acid transporter 1
UniProt Protein Name
Proton-coupled amino acid transporter 1
UniProt Gene Name
SLC36A1
UniProt Synonym Gene Names
PAT1; Proton/amino acid transporter 1; hPAT1
UniProt Entry Name
S36A1_HUMAN

NCBI Description

This gene encodes a member of the eukaryote-specific amino acid/auxin permease (AAAP) 1 transporter family. The encoded protein functions as a proton-dependent, small amino acid transporter. This gene is clustered with related family members on chromosome 5q33.1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

SLC36A1: Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid. Belongs to the amino acid/polyamine transporter 2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: endoplasmic reticulum; lysosomal membrane; integral to membrane; plasma membrane

Molecular Function: glycine transmembrane transporter activity; L-proline transmembrane transporter activity; hydrogen ion transmembrane transporter activity; hydrogen:amino acid symporter activity; L-alanine transmembrane transporter activity

Biological Process: glycine transport; proton transport; amino acid transport; ion transport; transmembrane transport; L-alanine transport

Research Articles on SLC36A1

Similar Products

Product Notes

The SLC36A1 slc36a1 (Catalog #AAA3246466) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC36A1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: STQRLRNEDY HDYSSTDVSP EESPSEGLNN LSSPGSYQRF GQSNSTTWFQ. It is sometimes possible for the material contained within the vial of "SLC36A1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.