Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-INPP5D AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit INPP5D Polyclonal Antibody | anti-INPP5D antibody

INPP5D antibody - C-terminal region

Gene Names
INPP5D; SHIP; SHIP1; SHIP-1; hp51CN; SIP-145; p150Ship
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
INPP5D; Polyclonal Antibody; INPP5D antibody - C-terminal region; anti-INPP5D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPL
Sequence Length
1189
Applicable Applications for anti-INPP5D antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-INPP5D AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-INPP5D AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-INPP5D antibody
This is a rabbit polyclonal antibody against INPP5D. It was validated on Western Blot

Target Description: This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. Overall, the protein functions as a negative regulator of myeliod cell proliferation and survival. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 isoform a
NCBI Official Synonym Full Names
inositol polyphosphate-5-phosphatase D
NCBI Official Symbol
INPP5D
NCBI Official Synonym Symbols
SHIP; SHIP1; SHIP-1; hp51CN; SIP-145; p150Ship
NCBI Protein Information
phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
UniProt Protein Name
Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
UniProt Gene Name
INPP5D
UniProt Synonym Gene Names
SHIP; SHIP1; SIP-145; SH2 domain-containing inositol phosphatase 1; SHIP-1; hp51CN
UniProt Entry Name
SHIP1_HUMAN

NCBI Description

This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

SHIP: an SH2-containing inositol phosphatase. A hemopoietic-specific phosphatase that regulates cell survival, growth, cell cycle arrest and apoptosis. Hydrolyzes Ins(1,3,4,5)P4 and PtdIns(3,4,5)P3. A cytosolic protein with a SH2 domain in its N-terminus and two NPXY Shc binding motifs at its C-terminus. Upon receptor cross-linking, SHIP is first recruited to the plasma membrane by its SH2, followed by tyrosine phosphorylation on the NPXY motif. Both membrane relocalization and phosphorylation are essential for its regulatory function. Associates with SHC after cytokine stimulation.

Protein type: Motility/polarity/chemotaxis; Phosphatase, lipid; EC 3.1.3.86

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: membrane; cytosol

Molecular Function: protein binding; inositol-polyphosphate 5-phosphatase activity; SH3 domain binding

Biological Process: inositol phosphate metabolic process; apoptosis; phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation; signal transduction; blood coagulation; leukocyte migration; phosphate metabolic process; T cell receptor signaling pathway

Research Articles on INPP5D

Similar Products

Product Notes

The INPP5D inpp5d (Catalog #AAA3215056) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INPP5D antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's INPP5D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INPP5D inpp5d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPTPTPRPPL PVKSPAVLHL QHSKGRDYRD NTELPHHGKH RPEEGPPGPL. It is sometimes possible for the material contained within the vial of "INPP5D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.