RIT1 blocking peptide

RIT1 Peptide - middle region

Cat. Num. AAA3247260

• Gene Names: RIT1; NS8; RIT; RIBB; ROC1
• Reactivity: Human
• Synonyms: RIT1; RIT1 Peptide - middle region; RIT1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: GSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAY
• Sequence Length: 219

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for RIT1 blocking peptide

This is a synthetic peptide designed for use in combination with anti- RIT1 Antibody, made

Target Description: This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants.

Product Categories/Family for RIT1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 378744212
• NCBI GeneID: 6016
• NCBI Accession #: NP_001243749.1
• NCBI GenBank Nucleotide #: NM_001256820.1
• UniProt Accession #: Q92963
• Molecular Weight: 24 kDa
• NCBI Official Full Name: GTP-binding protein Rit1 isoform 3
• NCBI Official Synonym Full Names: Ras like without CAAX 1
• NCBI Official Symbol: RIT1
• NCBI Official Synonym Symbols: NS8; RIT; RIBB; ROC1
• NCBI Protein Information: GTP-binding protein Rit1
• UniProt Protein Name: GTP-binding protein Rit1
• Protein Family: GTP-binding protein
• UniProt Gene Name: RIT1
• UniProt Synonym Gene Names: RIBB; RIT; ROC1
• UniProt Entry Name: RIT1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]

Uniprot Description

RIT1: a small G protein of the Ras family. Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and p38-alpha signaling pathways and in NGF- dependent neuronal differentiation. Stimulation of the NGF and EGF receptor signaling pathways results in rapid and prolonged activation. Interacts with afadin, the C-terminal domain of RalGDS and RLF, but not with RIN1 and PIK3CA. RLF binds exclusively to the active GTP-bound form. Strongly interacts with BRAF, but only weakly with c-Raf. BRAF and c-RAF association is dependent upon the GTP-bound state. Interacts with RGL3. Shows rapid uncatalyzed guanine nucleotide dissociation rates, which are much faster than those of most Ras subfamily members.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Ras

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: plasma membrane

Molecular Function: calmodulin binding; protein binding; GTP binding

Biological Process: nerve growth factor receptor signaling pathway; small GTPase mediated signal transduction; Ras protein signal transduction; signal transduction

Disease: Noonan Syndrome 8