Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human ALPK3 Monoclonal Antibody | anti-Alpk3 antibody

ALPK3 (Alpha-protein Kinase 3, Muscle alpha-protein Kinase, KIAA1330, MAK, FLJ12881, FLJ21176)

Gene Names
Alpk3; MAK; Midori; AW319487; mKIAA1330; D330016D04
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ALPK3; Monoclonal Antibody; ALPK3 (Alpha-protein Kinase 3; Muscle alpha-protein Kinase; KIAA1330; MAK; FLJ12881; FLJ21176); Anti -ALPK3 (Alpha-protein Kinase 3; anti-Alpk3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G4
Specificity
Recognizes human ALPK3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM
Applicable Applications for anti-Alpk3 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Immunogen
Partial recombinant corresponding to aa1811-1907 from human ALPK3 (NP_065829) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ALPK3 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ALPK3 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ALPK3 on HeLa cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ALPK3 on HeLa cell . [antibody concentration 10ug/ml].)
Related Product Information for anti-Alpk3 antibody
Kinase that recognizes phosphorylation sites in which the surrounding peptides have an alpha-helical conformation. Plays a role in cardiomyocyte differentiation.
Product Categories/Family for anti-Alpk3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
180,199 Da
NCBI Official Full Name
alpha-protein kinase 3
NCBI Official Synonym Full Names
alpha-kinase 3
NCBI Official Symbol
Alpk3
NCBI Official Synonym Symbols
MAK; Midori; AW319487; mKIAA1330; D330016D04
NCBI Protein Information
alpha-protein kinase 3; myocyte induction differentiation originator; myocytic induction/differentiation originator
UniProt Protein Name
Alpha-protein kinase 3
Protein Family
UniProt Gene Name
Alpk3
UniProt Synonym Gene Names
Kiaa1330; Midori
UniProt Entry Name
ALPK3_MOUSE

Uniprot Description

AlphaK1: Kinase that recognizes phosphorylation sites in which the surrounding peptides have an alpha-helical conformation. Plays a role in cardiomyocyte differentiation. Belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.

Protein type: EC 2.7.11.-; Protein kinase, atypical; Kinase, protein; ATYPICAL group; Alpha family

Cellular Component: nucleus

Molecular Function: AMP-activated protein kinase activity; GTP-dependent protein kinase activity; JUN kinase kinase kinase activity; cyclic nucleotide-dependent protein kinase activity; MAP kinase kinase kinase kinase activity; transmembrane receptor protein kinase activity; DNA-dependent protein kinase activity; JUN kinase activity; JUN kinase kinase activity; transmembrane receptor protein serine/threonine kinase activity; transferase activity; NF-kappaB-inducing kinase activity; MAP kinase kinase activity; protein serine/threonine kinase activity; cyclin-dependent protein kinase activating kinase activity; MAP kinase kinase kinase activity; SAP kinase activity; 3-phosphoinositide-dependent protein kinase activity; transferase activity, transferring phosphorus-containing groups; calcium-dependent protein kinase C activity; kinase activity; ribosomal protein S6 kinase activity; eukaryotic translation initiation factor 2alpha kinase activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: multicellular organismal development; heart development; phosphorylation; protein amino acid phosphorylation

Research Articles on Alpk3

Similar Products

Product Notes

The Alpk3 alpk3 (Catalog #AAA6013080) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALPK3 (Alpha-protein Kinase 3, Muscle alpha-protein Kinase, KIAA1330, MAK, FLJ12881, FLJ21176) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALPK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml. Researchers should empirically determine the suitability of the Alpk3 alpk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSHQCNAYCE LLGLTPLKGP EAAHPQAKAK GSKSPSAGRK GSQLSPQPQK KGLPSPQGTR KSAPSSKATP QASEPVTTQL LGQPPTQEEG SKAQGM. It is sometimes possible for the material contained within the vial of "ALPK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.