Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RHOB blocking peptide

RHOB Peptide - middle region

Gene Names
RHOB; ARH6; ARHB; RHOH6; MST081; MSTP081
Reactivity
Human
Applications
Western Blot
Synonyms
RHOB; RHOB Peptide - middle region; RHOB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY
Sequence Length
196
Applicable Applications for RHOB blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RHOB blocking peptide
This is a synthetic peptide designed for use in combination with anti-RHOB Antibody, made

Target Description: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.RHOB is also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.
Product Categories/Family for RHOB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
388
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoB
NCBI Official Synonym Full Names
ras homolog family member B
NCBI Official Symbol
RHOB
NCBI Official Synonym Symbols
ARH6; ARHB; RHOH6; MST081; MSTP081
NCBI Protein Information
rho-related GTP-binding protein RhoB
UniProt Protein Name
Rho-related GTP-binding protein RhoB
UniProt Gene Name
RHOB
UniProt Synonym Gene Names
ARH6; ARHB; h6
UniProt Entry Name
RHOB_HUMAN

Uniprot Description

RHOB: a small G protein of the Rho family. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Controls the reorganization of actins into podosomes. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders.

Protein type: Tumor suppressor; G protein, monomeric; G protein, monomeric, Rho; Motility/polarity/chemotaxis; G protein

Chromosomal Location of Human Ortholog: 2p24

Cellular Component: focal adhesion; late endosome membrane; early endosome; plasma membrane; endosome membrane; nucleus; cytosol; cleavage furrow

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: axon guidance; platelet activation; transformed cell apoptosis; metabolic process; apoptosis; positive regulation of apoptosis; cytokinesis; Rho protein signal transduction; negative regulation of cell cycle; intracellular protein transport; positive regulation of angiogenesis; regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; endosome to lysosome transport; angiogenesis; blood coagulation; cell adhesion

Research Articles on RHOB

Similar Products

Product Notes

The RHOB rhob (Catalog #AAA3236759) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RHOB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOB rhob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CPNVPIILVA NKKDLRSDEH VRTELARMKQ EPVRTDDGRA MAVRIQAYDY. It is sometimes possible for the material contained within the vial of "RHOB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.