Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RGS1 blocking peptide

RGS1 Peptide - N-terminal region

Gene Names
RGS1; 1R20; BL34; IER1; IR20; HEL-S-87
Reactivity
Human
Applications
Western Blot
Synonyms
RGS1; RGS1 Peptide - N-terminal region; RGS1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLS
Sequence Length
209
Applicable Applications for RGS1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RGS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RGS1 Antibody, made

Target Description: This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
Product Categories/Family for RGS1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
regulator of G-protein signaling 1
NCBI Official Synonym Full Names
regulator of G protein signaling 1
NCBI Official Symbol
RGS1
NCBI Official Synonym Symbols
1R20; BL34; IER1; IR20; HEL-S-87
NCBI Protein Information
regulator of G-protein signaling 1
UniProt Protein Name
Regulator of G-protein signaling 1
UniProt Gene Name
RGS1
UniProt Synonym Gene Names
1R20; BL34; IER1; RGS1
UniProt Entry Name
RGS1_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS1: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. This protein may be involved in the regulation of B-cell activation and proliferation. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: cytoplasm; plasma membrane

Molecular Function: calmodulin binding; GTPase activator activity

Biological Process: immune response; G-protein signaling, adenylate cyclase inhibiting pathway; signal transduction; positive regulation of GTPase activity

Research Articles on RGS1

Similar Products

Product Notes

The RGS1 rgs1 (Catalog #AAA3244441) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RGS1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RGS1 rgs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKGTTHSLLD DKMQKRRPKT FGMDMKAYLR SMIPHLESGM KSSKSKDVLS. It is sometimes possible for the material contained within the vial of "RGS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.