PSMB11 blocking peptide
PSMB11 Peptide - C-terminal region
Gene Names
PSMB11; BETA5T
Reactivity
Human
Applications
Western Blot
Synonyms
PSMB11; PSMB11 Peptide - C-terminal region; PSMB11 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED
Sequence Length
300
Applicable Applications for PSMB11 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PSMB11 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PSMB11 Antibody, made
Target Description: Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1, beta-2), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i, beta-2i, and beta-5i, are induced by gamma-interferon and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells .
Target Description: Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1, beta-2), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i, beta-2i, and beta-5i, are induced by gamma-interferon and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells .
Product Categories/Family for PSMB11 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
proteasome subunit beta type-11
NCBI Official Synonym Full Names
proteasome subunit beta 11
NCBI Official Symbol
PSMB11
NCBI Official Synonym Symbols
BETA5T
NCBI Protein Information
proteasome subunit beta type-11
UniProt Protein Name
Proteasome subunit beta type-11
Protein Family
UniProt Gene Name
PSMB11
UniProt Entry Name
PSB11_HUMAN
NCBI Description
Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1 (PSMB6; MIM 600307), beta-2 (PSMB7; MIM 604030), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i (PSMB9; MIM 177045), beta-2i (PSMB10; MIM 176847), and beta-5i (PSMB8; MIM 177046), are induced by gamma-interferon (IFNG; MIM 147570) and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells (Murata et al., 2007 [PubMed 17540904]).[supplied by OMIM, Mar 2008]
Research Articles on PSMB11
Similar Products
Product Notes
The PSMB11 psmb11 (Catalog #AAA3242302) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PSMB11 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMB11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSMB11 psmb11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HVRESGWEHV SRSDACVLYV ELQKLLEPEP EEDASHAHPE PATAHRAAED. It is sometimes possible for the material contained within the vial of "PSMB11, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
