Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PLPP2 blocking peptide

PLPP2 Peptide - C-terminal region

Gene Names
PLPP2; LPP2; PAP-2c; PAP2-g; PPAP2C
Reactivity
Human
Synonyms
PLPP2; PLPP2 Peptide - C-terminal region; PLPP2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
Sequence Length
288
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLPP2 blocking peptide
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for PLPP2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
phospholipid phosphatase 2 isoform 1
NCBI Official Synonym Full Names
phospholipid phosphatase 2
NCBI Official Symbol
PLPP2
NCBI Official Synonym Symbols
LPP2; PAP-2c; PAP2-g; PPAP2C
NCBI Protein Information
phospholipid phosphatase 2
UniProt Protein Name
Lipid phosphate phosphohydrolase 2
Protein Family
UniProt Gene Name
PPAP2C
UniProt Synonym Gene Names
LPP2; PAP2-G; PAP-2c; PAP2c
UniProt Entry Name
LPP2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is PA > C-1-P > LPA > S-1-P.

Catalytic activity: A 1,2-diacylglycerol 3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate.

Enzyme regulation: Inhibited by sphingosine, zinc ions and propanolol.

Subunit structure: Homodimer

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Found mainly in brain, pancreas and placenta.

Sequence similarities: Belongs to the PA-phosphatase related phosphoesterase family.

Research Articles on PLPP2

Similar Products

Product Notes

The PLPP2 ppap2c (Catalog #AAA3246896) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLPP2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVCYISDFFK ARPPQHCLKE EELERKPSLS LTLTLGEADH NHYGYPHSSS. It is sometimes possible for the material contained within the vial of "PLPP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.