Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRDX2 monoclonal antibody, Western Blot analysis of PRDX2 expression in Hela.)

Mouse anti-Human PRDX2 Monoclonal Antibody | anti-PRDX2 antibody

PRDX2 (Peroxiredoxin-2, Thioredoxin Peroxidase 1, Thioredoxin-dependent Peroxide Reductase 1, Thiol-specific Antioxidant Protein, TSA, PRP, Natural Killer Cell-enhancing Factor B, NKEF-B, TDPX1, NKEFB, MGC4104) (Biotin)

Gene Names
PRDX2; PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRDX2; Monoclonal Antibody; PRDX2 (Peroxiredoxin-2; Thioredoxin Peroxidase 1; Thioredoxin-dependent Peroxide Reductase 1; Thiol-specific Antioxidant Protein; TSA; PRP; Natural Killer Cell-enhancing Factor B; NKEF-B; TDPX1; NKEFB; MGC4104) (Biotin); anti-PRDX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E10-2D2
Specificity
Recognizes human PRDX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
948
Applicable Applications for anti-PRDX2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-199 from human PRDX2 (AAH00452) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRDX2 monoclonal antibody, Western Blot analysis of PRDX2 expression in Hela.)

Western Blot (WB) (PRDX2 monoclonal antibody, Western Blot analysis of PRDX2 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody. Lane 1: PRDX2 transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody. Lane 1: PRDX2 transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRDX2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PRDX2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRDX2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRDX2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PRDX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens peroxiredoxin 2, mRNA
NCBI Official Synonym Full Names
peroxiredoxin 2
NCBI Official Symbol
PRDX2
NCBI Official Synonym Symbols
PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a
NCBI Protein Information
peroxiredoxin-2
Protein Family

NCBI Description

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013]

Research Articles on PRDX2

Similar Products

Product Notes

The PRDX2 (Catalog #AAA6143719) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRDX2 (Peroxiredoxin-2, Thioredoxin Peroxidase 1, Thioredoxin-dependent Peroxide Reductase 1, Thiol-specific Antioxidant Protein, TSA, PRP, Natural Killer Cell-enhancing Factor B, NKEF-B, TDPX1, NKEFB, MGC4104) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRDX2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRDX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.