Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PAM16 blocking peptide

PAM16 Peptide - C-terminal region

Gene Names
PAM16; TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136
Reactivity
Human
Applications
Western Blot
Synonyms
PAM16; PAM16 Peptide - C-terminal region; PAM16 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Sequence Length
125
Applicable Applications for PAM16 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PAM16 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PAM16 Antibody, made

Target Description: PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Product Categories/Family for PAM16 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Synonym Full Names
presequence translocase associated motor 16
NCBI Official Symbol
PAM16
NCBI Official Synonym Symbols
TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136
NCBI Protein Information
mitochondrial import inner membrane translocase subunit TIM16
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM16
UniProt Gene Name
PAM16
UniProt Synonym Gene Names
MAGMAS; TIM16; TIMM16
UniProt Entry Name
TIM16_HUMAN

NCBI Description

This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017]

Uniprot Description

Magmas: Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. Belongs to the TIM16/PAM16 family.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrial matrix; protein complex

Molecular Function: protein binding

Biological Process: cellular protein metabolic process; negative regulation of ATPase activity; ossification; protein import into mitochondrial matrix; protein targeting to mitochondrion

Disease: Spondylometaphyseal Dysplasia, Megarbane-dagher-melki Type

Research Articles on PAM16

Similar Products

Product Notes

The PAM16 pam16 (Catalog #AAA3241564) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PAM16 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAM16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAM16 pam16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NYEHLFKVND KSVGGSFYLQ SKVVRAKERL DEELKIQAQE DREKGQMPHT. It is sometimes possible for the material contained within the vial of "PAM16, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.