Western Blot (WB)
(C9ORF25 antibody (MBS5301896) used at 1 ug/ml to detect target protein.)
Rabbit C9ORF25 Polyclonal Antibody | anti-C9ORF25 antibody
C9ORF25 antibody
Gene Names
FAM219A; C9orf25; bA573M23.5
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C9ORF25; Polyclonal Antibody; C9ORF25 antibody; Polyclonal C9ORF25; Anti-C9ORF25; Chromosome ORF 9; Chromosome 9 ORF; Chromosome ORF-9; FLJ39031; bA573M23.5; anti-C9ORF25 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C9ORF25 antibody was raised against the middle region of C9Orf25
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF25 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
156
Applicable Applications for anti-C9ORF25 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C9ORF25 antibody was raised using the middle region of C9Orf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C9ORF25 antibody (MBS5301896) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C9ORF25 antibody (MBS5301896) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C9ORF25 antibody
Rabbit polyclonal C9ORF25 antibody raised against the middle region of C9Orf25
Product Categories/Family for anti-C9ORF25 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
18 kDa (MW of target protein)
NCBI Official Full Name
C9orf25 protein
NCBI Official Synonym Full Names
family with sequence similarity 219, member A
NCBI Official Symbol
FAM219A
NCBI Official Synonym Symbols
C9orf25; bA573M23.5
NCBI Protein Information
protein FAM219A
UniProt Protein Name
Protein FAM219A
UniProt Gene Name
FAM219A
UniProt Synonym Gene Names
C9orf25
UniProt Entry Name
F219A_HUMAN
NCBI Description
The protein encoded by this gene has homologs that have been identified in mouse, macaque, etc organisms. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Dec 2010]
Uniprot Description
FAM219A iso2: has homologs that have been identified in mouse, macaque, etc organisms. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Dec 2010]
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 9p13.3
Similar Products
Product Notes
The C9ORF25 fam219a (Catalog #AAA5301896) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C9ORF25 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C9ORF25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C9ORF25 fam219a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9ORF25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
