Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KIF11 blocking peptide

KIF11 Peptide - N-terminal region

Gene Names
KIF11; EG5; HKSP; KNSL1; MCLMR; TRIP5
Reactivity
Human
Synonyms
KIF11; KIF11 Peptide - N-terminal region; KIF11 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDE
Sequence Length
1056
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KIF11 blocking peptide
This is a synthetic peptide designed for use in combination with anti-KIF11 Antibody, made

Target Description: This gene encodes a motor protein that belongs to the kinesin-like protein family. Members of this protein family are known to be involved in various kinds of spindle dynamics. The function of this gene product includes chromosome positioning, centrosome separation and establishing a bipolar spindle during cell mitosis.
Product Categories/Family for KIF11 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116kDa
NCBI Official Full Name
kinesin-like protein KIF11
NCBI Official Synonym Full Names
kinesin family member 11
NCBI Official Symbol
KIF11
NCBI Official Synonym Symbols
EG5; HKSP; KNSL1; MCLMR; TRIP5
NCBI Protein Information
kinesin-like protein KIF11
UniProt Protein Name
Kinesin-like protein KIF11
Protein Family
UniProt Gene Name
KIF11
UniProt Synonym Gene Names
EG5; KNSL1; TRIP5; TR-interacting protein 5; TRIP-5
UniProt Entry Name
KIF11_HUMAN

NCBI Description

This gene encodes a motor protein that belongs to the kinesin-like protein family. Members of this protein family are known to be involved in various kinds of spindle dynamics. The function of this gene product includes chromosome positioning, centrosome separation and establishing a bipolar spindle during cell mitosis. [provided by RefSeq, Jul 2008]

Uniprot Description

KIF11: a cytoskeletal protein that belongs to the kinesin-like protein family. BimC subfamily. Interacts with the thyroid hormone receptor in the presence of thyroid hormone. Plays a role in chromosome positioning, centrosome separation and establishing a bipolar spindle during cell mitosis. Phosphorylation regulates its association with the spindle apparatus.

Protein type: Microtubule-binding; Motor

Chromosomal Location of Human Ortholog: 10q24.1

Cellular Component: spindle pole; kinesin complex; microtubule; membrane; spindle microtubule; cytoplasm; spindle; cytosol

Molecular Function: plus-end-directed microtubule motor activity; microtubule binding; ATPase activity; protein complex binding; microtubule motor activity; protein kinase binding; ATP binding

Biological Process: mitosis; mitotic spindle organization and biogenesis; mitotic centrosome separation; cell division; metabolic process; regulation of mitotic centrosome separation; antigen processing and presentation of exogenous peptide antigen via MHC class II; blood coagulation; spindle organization and biogenesis; microtubule-based movement; chromosome segregation

Disease: Microcephaly With Or Without Chorioretinopathy, Lymphedema, Or Mental Retardation

Research Articles on KIF11

Similar Products

Product Notes

The KIF11 kif11 (Catalog #AAA3244748) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KIF11 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLEIYNEELF DLLNPSSDVS ERLQMFDDPR NKRGVIIKGL EEITVHNKDE. It is sometimes possible for the material contained within the vial of "KIF11, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.