Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 polyclonal antibody. Lane 1: EDN1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Endothelin 1 Polyclonal Antibody | anti-EDN1 antibody

Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (HRP)

Gene Names
EDN1; ET1; PPET1; HDLCQ7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Endothelin 1; Polyclonal Antibody; Endothelin 1 (Endothelin-1; EDN1; ET1; ET-1; HDLCQ7; Preproendothelin-1; PPET1) (HRP); anti-EDN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EDN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-EDN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EDN1, aa1-212 (AAH09720.1).
Immunogen Sequence
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 polyclonal antibody. Lane 1: EDN1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 polyclonal antibody. Lane 1: EDN1 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EDN1 antibody
Endothelins (ET) show potent constrictor activity in vascular and non-vascular smooth muscle. This family of 21aa peptides exists in at least three isoforms, ET-1, ET-2, and ET-3, and is produced in endothelial and epithelial cells. ET's can mediate biological effects in cells and tissues, and have been shown to bind to an ET receptor in the lung, kidney, heart and liver.
Product Categories/Family for anti-EDN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,425 Da
NCBI Official Full Name
Endothelin 1
NCBI Official Synonym Full Names
endothelin 1
NCBI Official Symbol
EDN1
NCBI Official Synonym Symbols
ET1; PPET1; HDLCQ7
NCBI Protein Information
endothelin-1; preproendothelin-1
UniProt Protein Name
Endothelin-1
Protein Family
UniProt Gene Name
EDN1
UniProt Synonym Gene Names
PPET1; ET-1
UniProt Entry Name
EDN1_HUMAN

NCBI Description

The protein encoded by this gene is proteolytically processed to release a secreted peptide termed endothelin 1. This peptide is a potent vasoconstrictor and is produced by vascular endothelial cells. Endothelin 1 also can affect the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

Uniprot Description

EDN1: Endothelins are endothelium-derived vasoconstrictor peptides. Belongs to the endothelin/sarafotoxin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p24.1

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: protein binding; hormone activity; endothelin B receptor binding; cytokine activity; endothelin A receptor binding

Biological Process: response to nicotine; positive regulation of JNK activity; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of nitric oxide biosynthetic process; regulation of systemic arterial blood pressure by endothelin; heart development; response to lipopolysaccharide; middle ear morphogenesis; prostaglandin biosynthetic process; sensory perception of pain; positive regulation of MAP kinase activity; elevation of cytosolic calcium ion concentration; negative regulation of cAMP biosynthetic process; cell surface receptor linked signal transduction; cell-cell signaling; negative regulation of nitric-oxide synthase biosynthetic process; protein kinase C activation; cell growth; neutrophil chemotaxis; rhythmic excitation; positive regulation of mitosis; negative regulation of blood coagulation; positive regulation of heart rate; response to testosterone stimulus; respiratory gaseous exchange; response to amino acid stimulus; peptide hormone secretion; leukocyte activation; patterning of blood vessels; membrane depolarization; protein kinase C deactivation; regulation of vasoconstriction; positive regulation of transcription from RNA polymerase II promoter; response to activity; superoxide release; positive regulation of odontogenesis; epithelial fluid transport; phosphoinositide 3-kinase cascade; positive regulation of cell size; neural crest cell development; G-protein signaling, phospholipase D activating pathway; positive regulation of smooth muscle cell proliferation; negative regulation of hormone secretion; negative regulation of cellular protein metabolic process; negative regulation of transcription from RNA polymerase II promoter; glucose transport; vein smooth muscle contraction; histamine secretion; nitric oxide transport; positive regulation of cell proliferation; regulation of pH; positive regulation of smooth muscle contraction; artery smooth muscle contraction; vasoconstriction; inositol phosphate-mediated signaling; in utero embryonic development; calcium-mediated signaling; positive regulation of hormone secretion; multicellular organismal aging; body fluid secretion; G-protein coupled receptor protein signaling pathway; dorsal/ventral pattern formation; response to ozone; cartilage development; positive regulation of prostaglandin secretion; maternal process involved in parturition; regulation of sensory perception of pain; positive regulation of cell migration

Disease: Question Mark Ears, Isolated; Auriculocondylar Syndrome 3

Research Articles on EDN1

Similar Products

Product Notes

The EDN1 edn1 (Catalog #AAA6377353) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Endothelin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDN1 edn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Endothelin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.