Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GDNF blocking peptide

GDNF Peptide - middle region

Gene Names
GDNF; ATF; ATF1; ATF2; HSCR3; HFB1-GDNF
Reactivity
Human
Synonyms
GDNF; GDNF Peptide - middle region; GDNF blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCV
Sequence Length
211
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GDNF blocking peptide
This is a synthetic peptide designed for use in combination with anti- GDNF Antibody, made

Target Description: This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene may be associated with Hirschsprung disease.
Product Categories/Family for GDNF blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
glial cell line-derived neurotrophic factor isoform 1 preproprotein
NCBI Official Synonym Full Names
glial cell derived neurotrophic factor
NCBI Official Symbol
GDNF
NCBI Official Synonym Symbols
ATF; ATF1; ATF2; HSCR3; HFB1-GDNF
NCBI Protein Information
glial cell line-derived neurotrophic factor
UniProt Protein Name
Glial cell line-derived neurotrophic factor
Protein Family
UniProt Gene Name
GDNF
UniProt Synonym Gene Names
hGDNF; ATF
UniProt Entry Name
GDNF_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]

Uniprot Description

GDNF: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Defects in GDNF may be a cause of Hirschsprung disease type 3 (HSCR3). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Belongs to the TGF-beta family. GDNF subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5p13.1-p12

Cellular Component: extracellular region

Molecular Function: protein homodimerization activity; growth factor activity; receptor binding

Biological Process: nervous system development; axon guidance; positive regulation of dopamine secretion; peristalsis; adult locomotory behavior; mRNA stabilization; positive regulation of monooxygenase activity; regulation of dopamine uptake; signal transduction; enteric nervous system development; sympathetic nervous system development; regulation of gene expression; ureteric bud branching; induction of an organ; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; postganglionic parasympathetic nervous system development; negative regulation of neuron apoptosis; postsynaptic membrane organization; positive regulation of cell differentiation; neural crest cell migration; metanephros development; neurite development; negative regulation of apoptosis

Disease: Hirschsprung Disease, Susceptibility To, 3; Central Hypoventilation Syndrome, Congenital; Pheochromocytoma

Research Articles on GDNF

Similar Products

Product Notes

The GDNF gdnf (Catalog #AAA3246012) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GDNF Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATIKRLKRSP DKQMAVLPRR ERNRQAAAAN PENSRGKGRR GQRGKNRGCV. It is sometimes possible for the material contained within the vial of "GDNF, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.