Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GDNF expression in transfected 293T cell line by GDNF polyclonal antibody. Lane 1: GDNF transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GDNF Polyclonal Antibody | anti-GDNF antibody

GDNF (Glial Cell Line-derived Neurotrophic Factor, hGDNF, Astrocyte-derived Trophic Factor, ATF) (Biotin)

Gene Names
GDNF; ATF1; ATF2; HSCR3; HFB1-GDNF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GDNF; Polyclonal Antibody; GDNF (Glial Cell Line-derived Neurotrophic Factor; hGDNF; Astrocyte-derived Trophic Factor; ATF) (Biotin); anti-GDNF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GDNF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GDNF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GDNF, aa1-211 (NP_000505.1).
Immunogen Sequence
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GDNF expression in transfected 293T cell line by GDNF polyclonal antibody. Lane 1: GDNF transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GDNF expression in transfected 293T cell line by GDNF polyclonal antibody. Lane 1: GDNF transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GDNF antibody
GDNF is a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described.
Product Categories/Family for anti-GDNF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,123 Da
NCBI Official Full Name
glial cell line-derived neurotrophic factor isoform 1 preproprotein
NCBI Official Synonym Full Names
glial cell derived neurotrophic factor
NCBI Official Symbol
GDNF
NCBI Official Synonym Symbols
ATF1; ATF2; HSCR3; HFB1-GDNF
NCBI Protein Information
glial cell line-derived neurotrophic factor; ATF; astrocyte-derived trophic factor
UniProt Protein Name
Glial cell line-derived neurotrophic factor
Protein Family
UniProt Gene Name
GDNF
UniProt Synonym Gene Names
hGDNF; ATF
UniProt Entry Name
GDNF_HUMAN

NCBI Description

This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq, Jun 2010]

Uniprot Description

GDNF: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Defects in GDNF may be a cause of Hirschsprung disease type 3 (HSCR3). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Belongs to the TGF-beta family. GDNF subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5p13.1-p12

Cellular Component: extracellular region

Molecular Function: protein homodimerization activity; growth factor activity; receptor binding

Biological Process: nervous system development; axon guidance; positive regulation of dopamine secretion; peristalsis; adult locomotory behavior; mRNA stabilization; positive regulation of monooxygenase activity; regulation of dopamine uptake; signal transduction; enteric nervous system development; sympathetic nervous system development; regulation of gene expression; ureteric bud branching; induction of an organ; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; postganglionic parasympathetic nervous system development; negative regulation of neuron apoptosis; postsynaptic membrane organization; positive regulation of cell differentiation; neural crest cell migration; metanephros development; neurite development; negative regulation of apoptosis

Disease: Hirschsprung Disease, Susceptibility To, 3; Central Hypoventilation Syndrome, Congenital; Pheochromocytoma

Research Articles on GDNF

Similar Products

Product Notes

The GDNF gdnf (Catalog #AAA6379683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GDNF (Glial Cell Line-derived Neurotrophic Factor, hGDNF, Astrocyte-derived Trophic Factor, ATF) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GDNF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GDNF gdnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GDNF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.