Rabbit anti-Human GDNF Polyclonal Antibody | anti-GDNF antibody

GDNF (Glial Cell Line-derived Neurotrophic Factor, hGDNF, Astrocyte-derived Trophic Factor, ATF) (HRP)

Cat. Num. AAA6379685

• Gene Names: GDNF; ATF1; ATF2; HSCR3; HFB1-GDNF
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GDNF; Polyclonal Antibody; GDNF (Glial Cell Line-derived Neurotrophic Factor; hGDNF; Astrocyte-derived Trophic Factor; ATF) (HRP); anti-GDNF antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GDNF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-GDNF antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GDNF, aa1-211 (NP_000505.1).
• Immunogen Sequence: MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GDNF expression in transfected 293T cell line by GDNF polyclonal antibody. Lane 1: GDNF transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GDNF antibody

GDNF is a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described.

Product Categories/Family for anti-GDNF antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4503975
• NCBI GeneID: 2668
• NCBI Accession #: NP_000505.1
• NCBI GenBank Nucleotide #: NM_000514
• UniProt Accession #: P39905; O95448; O95449; O95986; Q6FH33; Q96L44; Q9UD32; Q9UD33; Q9UMV2; Q9UP67; Q9UP97; B7WPK7; AAB33493; AAB33494
• Molecular Weight: 18,123 Da
• NCBI Official Full Name: glial cell line-derived neurotrophic factor isoform 1 preproprotein
• NCBI Official Synonym Full Names: glial cell derived neurotrophic factor
• NCBI Official Symbol: GDNF
• NCBI Official Synonym Symbols: ATF1; ATF2; HSCR3; HFB1-GDNF
• NCBI Protein Information: glial cell line-derived neurotrophic factor; ATF; astrocyte-derived trophic factor
• UniProt Protein Name: Glial cell line-derived neurotrophic factor
• Protein Family: GDNF family receptor
• UniProt Gene Name: GDNF
• UniProt Synonym Gene Names: hGDNF; ATF
• UniProt Entry Name: GDNF_HUMAN

NCBI Description

This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq, Jun 2010]

Uniprot Description

GDNF: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Defects in GDNF may be a cause of Hirschsprung disease type 3 (HSCR3). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Belongs to the TGF-beta family. GDNF subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5p13.1-p12

Cellular Component: extracellular region

Molecular Function: protein homodimerization activity; growth factor activity; receptor binding

Biological Process: nervous system development; axon guidance; positive regulation of dopamine secretion; peristalsis; adult locomotory behavior; mRNA stabilization; positive regulation of monooxygenase activity; regulation of dopamine uptake; signal transduction; enteric nervous system development; sympathetic nervous system development; regulation of gene expression; ureteric bud branching; induction of an organ; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; postganglionic parasympathetic nervous system development; negative regulation of neuron apoptosis; postsynaptic membrane organization; positive regulation of cell differentiation; neural crest cell migration; metanephros development; neurite development; negative regulation of apoptosis

Disease: Hirschsprung Disease, Susceptibility To, 3; Central Hypoventilation Syndrome, Congenital; Pheochromocytoma