CAPN6 blocking peptide

CAPN6 Peptide - middle region

Cat. Num. AAA3246053

• Gene Names: CAPN6; CANPX; CAPNX; CalpM; DJ914P14.1
• Reactivity: Human
• Synonyms: CAPN6; CAPN6 Peptide - middle region; CAPN6 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
• Sequence Length: 641

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CAPN6 blocking peptide

This is a synthetic peptide designed for use in combination with anti- CAPN6 Antibody, made

Target Description: Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis.

Product Categories/Family for CAPN6 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 13186316
• NCBI GeneID: 827
• NCBI Accession #: NP_055104.2
• NCBI GenBank Nucleotide #: NM_014289.3
• UniProt Accession #: Q9Y6Q1
• Molecular Weight: 75 kDa
• NCBI Official Full Name: calpain-6
• NCBI Official Synonym Full Names: calpain 6
• NCBI Official Symbol: CAPN6
• NCBI Official Synonym Symbols: CANPX; CAPNX; CalpM; DJ914P14.1
• NCBI Protein Information: calpain-6
• UniProt Protein Name: Calpain-6
• Protein Family: Calpain
• UniProt Gene Name: CAPN6
• UniProt Synonym Gene Names: CALPM; CANPX; CalpM
• UniProt Entry Name: CAN6_HUMAN

NCBI Description

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis. [provided by RefSeq, Nov 2009]

Uniprot Description

CAPN6: Microtubule-stabilizing protein that may be involved in the regulation of microtubule dynamics and cytoskeletal organization. May act as a regulator of RAC1 activity through interaction with ARHGEF2 to control lamellipodial formation and cell mobility. Does not seem to have protease activity as it has lost the active site residues. Belongs to the peptidase C2 family.

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: spindle microtubule; perinuclear region of cytoplasm

Molecular Function: microtubule binding; calcium-dependent cysteine-type endopeptidase activity

Biological Process: proteolysis; microtubule bundle formation; regulation of cytoskeleton organization and biogenesis