Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-6 R alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

IL-6 R alpha Active Protein | IL6R active protein

Recombinant Human IL-6 R alpha Protein

Gene Names
IL6R; IL6Q; gp80; CD126; IL6RA; IL6RQ; IL-6RA; IL-6R-1
Purity
>92% by SDS-PAGE.
Synonyms
IL-6 R alpha; Recombinant Human IL-6 R alpha Protein; CD126; gp80; IL-6R; IL-6R-1; IL-6RA; IL6Q; IL6RQ; IL6R active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Sequence Length
53
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL6R at 1 ug/mL (100 uL/well) can bind Human IL-6 with a linear range of 2-15ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-6 R alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

SDS-Page (Recombinant Human IL-6 R alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)
Related Product Information for IL6R active protein
Description: Recombinant Human IL-6 R alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp358) of human IL-6 R alpha (Accession #NP_000556.1) fused with a 6xHis tag at the C-terminus.

Background: The soluble form of recombinant human IL6R consists of 357 amino acids with a molecular weight of 40 kDa. It migrates with an apparent molecular mass of 60-65 kDa due to glycosylation in SDS-PAGE under reducing conditions. Interleukin 6 receptor (IL-6R) also known as CD126 (Cluster of Differentiation 126) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL-6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL-6R protein are able to mediate IL-6 signals into the cells through the interaction of gp13. The resulting IL-6/sIL-6R protein complex is also capable of binding to gp13 and inducing intracellular signalling. Through this so-called 'trans-signalling' mechanism, IL-6 is able to stimulate cells that lack an endogenous mIL-6R. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases.
Product Categories/Family for IL6R active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Soluble interleukin-6 receptor, partial
NCBI Official Synonym Full Names
interleukin 6 receptor
NCBI Official Symbol
IL6R
NCBI Official Synonym Symbols
IL6Q; gp80; CD126; IL6RA; IL6RQ; IL-6RA; IL-6R-1
NCBI Protein Information
interleukin-6 receptor subunit alpha
UniProt Protein Name
Interleukin-6 receptor subunit alpha
Protein Family
UniProt Gene Name
IL6R
UniProt Synonym Gene Names
IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; gp80
UniProt Entry Name
IL6RA_HUMAN

NCBI Description

This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.[provided by RefSeq, May 2011]

Uniprot Description

IL6R: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. Belongs to the type I cytokine receptor family. Type 3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; basolateral plasma membrane; apical plasma membrane; extracellular region; plasma membrane; interleukin-6 receptor complex

Molecular Function: protein binding; interleukin-6 binding; protein homodimerization activity; enzyme binding; interleukin-6 receptor binding; ciliary neurotrophic factor receptor activity; interleukin-6 receptor activity

Biological Process: positive regulation of smooth muscle cell proliferation; negative regulation of collagen biosynthetic process; cytokine and chemokine mediated signaling pathway; neutrophil mediated immunity; positive regulation of interleukin-6 production; positive regulation of leukocyte chemotaxis; defense response to Gram-negative bacterium; endocrine pancreas development; positive regulation of chemokine production; activation of NF-kappaB transcription factor; positive regulation of tyrosine phosphorylation of Stat3 protein; monocyte chemotaxis; positive regulation of osteoblast differentiation; positive regulation of peptidyl-tyrosine phosphorylation; defense response to Gram-positive bacterium; positive regulation of MAPKKK cascade; response to cytokine stimulus; positive regulation of cell proliferation; acute-phase response; negative regulation of interleukin-8 production; hepatic immune response

Disease: Interleukin 6, Serum Level Of, Quantitative Trait Locus; Soluble Interleukin-6 Receptor, Serum Level Of, Quantitative Trait Locus

Research Articles on IL6R

Similar Products

Product Notes

The IL6R il6r (Catalog #AAA9141718) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LAPRRCPAQE VARGVLTSLP GDSVTLTCPG VEPEDNATVH WVLRKPAAGS HPSRWAGMGR RLLLRSVQLH DSGNYSCYRA GRPAGTVHLL VDVPPEEPQL SCFRKSPLSN VVCEWGPRST PSLTTKAVLL VRKFQNSPAE DFQEPCQYSQ ESQKFSCQLA VPEGDSSFYI VSMCVASSVG SKFSKTQTFQ GCGILQPDPP ANITVTAVAR NPRWLSVTWQ DPHSWNSSFY RLRFELRYRA ERSKTFTTWM VKDLQHHCVI HDAWSGLRHV VQLRAQEEFG QGEWSEWSPE AMGTPWTESR SPPAENEVST PMQALTTNKD DDNILFRDSA NATSLPVQD. It is sometimes possible for the material contained within the vial of "IL-6 R alpha, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.