ATP-dependent zinc metalloprotease FTSH 4 (FTSH4) Recombinant Protein | FTSH4 recombinant protein
Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 4, mitochondrial (FTSH4)
Gene Names
ftsh4; FTSH protease 4; ftsh4; T19L18.5; T19L18_5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease FTSH 4 (FTSH4); Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 4; mitochondrial (FTSH4); FTSH4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-717aa; full length protein
Sequence
SSFPRVGVTGAVGGGGASLPRTRFQSSYVGSFARRVRDREEVNEVAHLRELIRRNDPEAV IRMFESQPSLHANASALSEYIKALVKVDRLDQSELVRTLQRGIAGVAREEETFGGLGAFR NVGKPTKDGVLGTASAPIHTISTERTHFKEQLWSTIRTIGVGFLLISGIGALIEDRGIGK GLGLHEEVQPSMDSSTKFSDVKGVDEAKAELEEIVHYLRDPKRFTRLGGKLPKGVLLVGP PGTGKTMLARAIAGEAGVPFFSCSGSEFEEMFVGVGARRVRDLFSAAKKCSPCIIFIDEI DAIGGSRNPKDQQYMKMTLNQMLVELDGFKQNEGIIVVAATNFPESLDKALVRPGRFDRH IVVPNPDVEGRRQILESHMSKVLKAEDVDLMIIARGTPGFSGADLANLVNVAALKAAMDG SKDVTMSDLEFAKDRIMMGSERKSAVISDESRKLTAFHEGGHALVAIHTEGALPVHKATI VPRGMALGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLEQA TKLARAMVTKFGMSKEVGLVAHNYDDNGKSMSTETRLLIESEVKQLLEKAYNNAKTILTV YNKELHALANALLQHETLSGKQIKELLTDLNSPLLQKRQEVVTKQSNPVPPSTPSSASSA AAAAAAAAAAAAAAAATAATKGKDMAPVS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FTSH4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
77,275 Da
NCBI Official Full Name
cell division protease ftsH-4
NCBI Official Symbol
ftsh4
NCBI Official Synonym Symbols
FTSH protease 4; ftsh4; T19L18.5; T19L18_5
NCBI Protein Information
cell division protease ftsH-4
UniProt Protein Name
ATP-dependent zinc metalloprotease FTSH 4, mitochondrial
Protein Family
UniProt Gene Name
FTSH4
UniProt Synonym Gene Names
AtFTSH4
UniProt Entry Name
FTSH4_ARATH
NCBI Description
encodes an FtsH protease that is localized to the mitochondrion
Uniprot Description
Probable ATP-dependent zinc metallopeptidase. Involved in the assembly and/or stability of the complex V of the mitochondrial oxidative phosphorylation system.
Research Articles on FTSH4
Similar Products
Product Notes
The FTSH4 ftsh4 (Catalog #AAA7015288) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-717aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FTSH4 ftsh4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSFPRVGVTG AVGGGGASLP RTRFQSSYVG SFARRVRDRE EVNEVAHLRE LIRRNDPEAV IRMFESQPSL HANASALSEY IKALVKVDRL DQSELVRTLQ RGIAGVAREE ETFGGLGAFR NVGKPTKDGV LGTASAPIHT ISTERTHFKE QLWSTIRTIG VGFLLISGIG ALIEDRGIGK GLGLHEEVQP SMDSSTKFSD VKGVDEAKAE LEEIVHYLRD PKRFTRLGGK LPKGVLLVGP PGTGKTMLAR AIAGEAGVPF FSCSGSEFEE MFVGVGARRV RDLFSAAKKC SPCIIFIDEI DAIGGSRNPK DQQYMKMTLN QMLVELDGFK QNEGIIVVAA TNFPESLDKA LVRPGRFDRH IVVPNPDVEG RRQILESHMS KVLKAEDVDL MIIARGTPGF SGADLANLVN VAALKAAMDG SKDVTMSDLE FAKDRIMMGS ERKSAVISDE SRKLTAFHEG GHALVAIHTE GALPVHKATI VPRGMALGMV SQLPDKDETS ISRKQMLARL DVCMGGRVAE ELIFGESEVT SGASSDLEQA TKLARAMVTK FGMSKEVGLV AHNYDDNGKS MSTETRLLIE SEVKQLLEKA YNNAKTILTV YNKELHALAN ALLQHETLSG KQIKELLTDL NSPLLQKRQE VVTKQSNPVP PSTPSSASSA AAAAAAAAAA AAAAAATAAT KGKDMAPVS. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease FTSH 4 (FTSH4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
