Rabbit EBP1 Polyclonal Antibody | anti-PA2G4 antibody

Anti-EBP1 Antibody

Cat. Num. AAA178670

• Gene Names: PA2G4; EBP1; HG4-1; p38-2G4
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: EBP1; Polyclonal Antibody; Anti-EBP1 Antibody; hG4 1; hG4-1; Mpp1; p38 2G4; Pa2g4; Plfap; Q9UQ80; Proliferation-associated protein 2G4; proliferation-associated 2G4; anti-PA2G4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 394

• Applicable Applications for anti-PA2G4 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Predicted Species: Species predicted to be fit for the product based on sequence similarities.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of EBP1 expression in rat liver extract (lane 1), NIH3T3 whole cell lysates (lane 2) and HEPG2 whole cell lysates (lane 3). EBP1 at 43KD was detected using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(EBP1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(EBP1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(EBP1 was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-PA2G4 antibody

Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection.
Background: Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases.

References

1. Lamartine J, Seri M, Cinti R, Heitzmann F, Creaven M, Radomski N, Jost E, Lenoir GM, Romeo G, Sylla BS (November 1997). "Molecular cloning and mapping of a human cDNA (PA2G4) that encodes a protein highly homologous to the mouse cell cycle protein p38-2G4". Cytogenet Cell Genet. 78 (1): 31-5.
2. "Entrez Gene: PA2G4 proliferation-associated 2G4, 38kDa".

NCBI and Uniprot Product Information

• NCBI GI #: 124494254
• NCBI GeneID: 5036
• NCBI Accession #: NP_006182.2
• NCBI GenBank Nucleotide #: NM_006191.2
• UniProt Accession #: Q9UQ80; O43846; Q9UM59
• Molecular Weight: 38,059 Da
• NCBI Official Full Name: proliferation-associated protein 2G4
• NCBI Official Synonym Full Names: proliferation-associated 2G4
• NCBI Official Symbol: PA2G4
• NCBI Official Synonym Symbols: EBP1; HG4-1; p38-2G4
• NCBI Protein Information: proliferation-associated protein 2G4
• UniProt Protein Name: Proliferation-associated protein 2G4
• Protein Family: Proliferation-associated protein
• UniProt Gene Name: PA2G4
• UniProt Synonym Gene Names: EBP1; hG4-1

NCBI Description

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Ebp1: May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly. Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). Belongs to the peptidase M24 family.

Protein type: Nuclear receptor co-regulator; Nucleolus; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: cytoplasm; membrane; nucleolus; nucleoplasm; nucleus

Molecular Function: DNA binding; protein binding; transcription factor activity; ubiquitin protein ligase binding

Biological Process: cell cycle arrest; cell proliferation; negative regulation of apoptosis; negative regulation of transcription, DNA-dependent; positive regulation of cell differentiation