Bis(5'-adenosyl)-triphosphatase Recombinant Protein | FHIT recombinant protein

Recombinant Human Bis(5'-adenosyl)-triphosphatase

Cat. Num. AAA949393

• Gene Names: FHIT; FRA3B; AP3Aase
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Bis(5'-adenosyl)-triphosphatase; Recombinant Human Bis(5'-adenosyl)-triphosphatase; AP3A hydrolase; AP3; Aase; Diadenosine 5'; 5'''-P1; P3-triphosphate hydrolase; Dinucleosidetriphosphatase; Fragile histidine triad protein; FHIT recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-147aa; Full Length
• Sequence: SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
• Sequence Length: 147

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FHIT recombinant protein

Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca2+ transporters, enhancing mitochondrial calcium uptake. Functions as tumor suppressor

Product Categories/Family for FHIT recombinant protein

Epigenetics and Nuclear Signaling

References

The FHIT gene, spanning the chromosome 3p14.2 fragile site and renal carcinoma-associated t(3;8) breakpoint, is abnormal in digestive tract cancers.Ohta M., Inoue H., Cotticelli M.G., Kastury K., Baffa R., Palazzo J., Siprashvili Z., Mori M., McCue P., Druck T., Croce C.M., Huebner K.Cell 84:587-597(1996) Structure and expression of the human FHIT gene in normal and tumor cells.Druck T., Hadaczek P., Fu T.B., Ohta M., Siprashvili Z., Baffa R., Negrini M., Kastury K., Veronese M.L., Rosen D., Rothstein J., McCue P., Cotticelli M.G., Inoue H., Croce C.M., Huebner K.Cancer Res. 57:504-512(1997) Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.Corominas R., Yang X., Lin G.N., Kang S., Shen Y., Ghamsari L., Broly M., Rodriguez M., Tam S., Wanamaker S.A., Fan C., Yi S., Tasan M., Lemmens I., Kuang X., Zhao N., Malhotra D., Michaelson J.J., Vacic V., Calderwood M.A., Roth F.P., Tavernier J., Horvath S., Salehi-Ashtiani K., Korkin D., Sebat J., Hill D.E., Hao T., Vidal M., Iakoucheva L.M.Nat. Commun. 5:3650-3650(2014) Mutational analysis of FHIT gene.Naqvi S.R.A., Malik A., Kukreti H., Chaudhary A., Anand R., Deo S.S., Shukla N.K., Husain S.A., Pasha S.T.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Fhit, a putative tumor suppressor in humans, is a dinucleoside 5',5''-P1,P3-triphosphate hydrolase.Barnes L.D., Garrison P.N., Siprashvili Z., Guranowski A., Robinson A.K., Ingram S.W., Croce C.M., Ohta M., Huebner K.Biochemistry 35:11529-11535(1996) The hereditary renal cell carcinoma 3;8 translocation fuses FHIT to a patched-related gene, TRC8.Gemmill R.M., West J.D., Boldog F., Tanaka N., Robinson L.J., Smith D.I., Li F., Drabkin H.A.Proc. Natl. Acad. Sci. U.S.A. 95:9572-9577(1998) Association of FHIT (fragile histidine triad) , a candidate tumour suppressor gene, with the ubiquitin-conjugating enzyme hUBC9.Shi Y., Zou M., Farid N.R., Paterson M.C.Biochem. J. 352:443-448(2000) Designed FHIT alleles establish that Fhit-induced apoptosis in cancer cells is limited by substrate binding.Trapasso F., Krakowiak A., Cesari R., Arkles J., Yendamuri S., Ishii H., Vecchione A., Kuroki T., Bieganowski P., Pace H.C., Huebner K., Croce C.M., Brenner C.Proc. Natl. Acad. Sci. U.S.A. 100:1592-1597(2003) The mechanism of action of the fragile histidine triad, Fhit isolation of a covalent adenylyl enzyme and chemical rescue of H96G-Fhit.Huang K., Arabshahi A., Wei Y., Frey P.A.Biochemistry 43:7637-7642(2004) Synergistic tumor suppression by coexpression of FHIT and p53 coincides with FHIT-mediated MDM2 inactivation and p53 stabilization in human non-small cell lung cancer cells.Nishizaki M., Sasaki J., Fang B., Atkinson E.N., Minna J.D., Roth J.A., Ji L.Cancer Res. 64:5745-5752(2004) Fhit is a physiological target of the protein kinase Src.Pekarsky Y., Garrison P.N., Palamarchuk A., Zanesi N., Aqeilan R.I., Huebner K., Barnes L.D., Croce C.M.Proc. Natl. Acad. Sci. U.S.A. 101:3775-3779(2004) Fhit modulation of the Akt-survivin pathway in lung cancer cells Fhit-tyrosine 114 (Y114) is essential.Semba S., Trapasso F., Fabbri M., McCorkell K.A., Volinia S., Druck T., Iliopoulos D., Pekarsky Y., Ishii H., Garrison P.N., Barnes L.D., Croce C.M., Huebner K.Oncogene 25:2860-2872(2006) The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity.Weiske J., Albring K.F., Huber O.Proc. Natl. Acad. Sci. U.S.A. 104:20344-20349(2007) Intramitochondrial calcium regulation by the FHIT gene product sensitizes to apoptosis.Rimessi A., Marchi S., Fotino C., Romagnoli A., Huebner K., Croce C.M., Pinton P., Rizzuto R.Proc. Natl. Acad. Sci. U.S.A. 106:12753-12758(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family.Lima C.D., D'Amico K.L., Naday I., Rosenbaum G., Westbrook E.M., Hendrickson W.A.Structure 5:763-774(1997) Structure-based analysis of catalysis and substrate definition in the HIT protein family.Lima C.D., Klein M.G., Hendrickson W.A.Science 278:286-290(1997) Genetic, biochemical, and crystallographic characterization of Fhit-substrate complexes as the active signaling form of Fhit.Pace H.C., Garrison P.N., Robinson A.K., Barnes L.D., Draganescu A., Roesler A., Blackburn G.M., Siprashvili Z., Croce C.M., Huebner K., Brenner C.Proc. Natl. Acad. Sci. U.S.A. 95:5484-5489(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 261278358
• NCBI GeneID: 2272
• NCBI Accession #: NP_001159715.1
• NCBI GenBank Nucleotide #: NM_001166243.1
• UniProt Accession #: P49789; Q45QG9; Q6IU12; A2IAS9; A2IAT0; A2IAT6; A8K1A9
• Molecular Weight: 20.7 kDa
• NCBI Official Full Name: bis(5'-adenosyl)-triphosphatase
• NCBI Official Synonym Full Names: fragile histidine triad
• NCBI Official Symbol: FHIT
• NCBI Official Synonym Symbols: FRA3B; AP3Aase
• NCBI Protein Information: bis(5'-adenosyl)-triphosphatase
• UniProt Protein Name: Bis(5'-adenosyl)-triphosphatase
• Protein Family: Bis(5'-adenosyl)-triphosphatase
• UniProt Gene Name: FHIT
• UniProt Synonym Gene Names: AP3Aase
• UniProt Entry Name: FHIT_HUMAN

NCBI Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

FHIT: a member of the histidine triad gene family. A diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. Its gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. A possible tumor suppressor in specific tissues. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines. Aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas.

Protein type: Nucleotide Metabolism - purine; Motility/polarity/chemotaxis; Hydrolase; Tumor suppressor; DNA replication; EC 3.6.1.29

Chromosomal Location of Human Ortholog: 3p14.2

Cellular Component: cytoplasm; cytosol; mitochondrion; nucleus

Molecular Function: bis(5'-adenosyl)-triphosphatase activity; catalytic activity; hydrolase activity; identical protein binding; nucleotide binding; protein binding; ubiquitin protein ligase binding

Biological Process: DNA replication; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; nucleotide metabolic process; purine nucleotide metabolic process; regulation of transcription, DNA-dependent; transcription, DNA-dependent