Bis(5'-adenosyl)-triphosphatase Recombinant Protein | Fhit recombinant protein

Recombinant Mouse Bis(5'-adenosyl)-triphosphatase

Cat. Num. AAA1190465

• Gene Names: Fhit; Fra14A2; AW045638
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Bis(5'-adenosyl)-triphosphatase; Recombinant Mouse Bis(5'-adenosyl)-triphosphatase; AP3A hydrolase; AP3; Aase; Diadenosine 5'; 5'''-P1; P3-triphosphate hydrolase; Dinucleosidetriphosphatase; Fragile histidine triad protein; Fhit recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-150aa; Full Length
• Sequence: SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA
• Sequence Length: 150

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Fhit recombinant protein

Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity. Functions as tumor suppressor.

References

The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408(1998) Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans.Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998) Muir-Torre-like syndrome in Fhit-deficient mice.Fong L.Y., Fidanza V., Zanesi N., Lock L.F., Siracusa L.D., Mancini R., Siprashvili Z., Ottey M., Martin S.E., Druck T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 97:4742-4747(2000) The tumor spectrum in FHIT-deficient mice.Zanesi N., Fidanza V., Fong L.Y., Mancini R., Druck T., Valtieri M., Rudiger T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 98:10250-10255(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 815930058
• NCBI GeneID: 14198
• NCBI Accession #: NP_001295215.1
• NCBI GenBank Nucleotide #: NM_001308286.1
• UniProt Accession #: O89106; Q6URW5; Q91VL1
• Molecular Weight: 19.1 kDa
• NCBI Official Full Name: bis(5'-adenosyl)-triphosphatase isoform 2
• NCBI Official Synonym Full Names: fragile histidine triad gene
• NCBI Official Symbol: Fhit
• NCBI Official Synonym Symbols: Fra14A2; AW045638
• NCBI Protein Information: bis(5'-adenosyl)-triphosphatase
• UniProt Protein Name: Bis(5'-adenosyl)-triphosphatase
• Protein Family: Bis(5'-adenosyl)-triphosphatase
• UniProt Gene Name: Fhit
• UniProt Synonym Gene Names: AP3Aase
• UniProt Entry Name: FHIT_MOUSE

NCBI Description

This gene encodes a member of the HIT family of proteins that are characterized by the presence of a histidine triad sequence. The encoded protein is a diadenosine triphosphate hydrolase enzyme that cleaves the P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. This locus is very fragile and has been found to be altered in different types of cancers. Mice lacking the encoded protein display increased susceptibility to spontaneous and induced tumors. Ectopic expression of the encoded protein in such knockout mice inhibits tumor development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

FHIT: a member of the histidine triad gene family. A diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. Its gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. A possible tumor suppressor in specific tissues. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines. Aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas.

Protein type: Motility/polarity/chemotaxis; Tumor suppressor; Hydrolase; DNA replication; EC 3.6.1.29; Nucleotide Metabolism - purine

Cellular Component: cytoplasm; cytosol; intracellular; nucleus; plasma membrane

Molecular Function: bis(5'-adenosyl)-triphosphatase activity; catalytic activity; hydrolase activity; identical protein binding; nickel ion binding; nucleotide binding; ubiquitin protein ligase binding

Biological Process: apoptosis; diadenosine triphosphate catabolic process; DNA replication; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; nucleotide metabolic process; purine nucleotide metabolic process; regulation of transcription, DNA-dependent; transcription, DNA-dependent