Fc epsilon RI alpha Recombinant Protein | FCER1A recombinant protein

Recombinant Human Fc epsilon RI alpha Protein

Cat. Num. AAA9141797

• Gene Names: FCER1A; FCE1A; FcERI
• Purity: >95% by SDS-PAGE.
• Synonyms: Fc epsilon RI alpha; Recombinant Human Fc epsilon RI alpha Protein; FcERI; FCER1A recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
• Sequence Length: 257

• Species: Human
• Endotoxin: < 0.01 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Fc epsilon RI alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-50 kDa.)

Related Product Information for FCER1A recombinant protein

Description: Recombinant Human Fc epsilon RI alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Gln205) of human Fc epsilon RI alpha (Accession #NP_001992) fused with a 6xHis tag at the C-terminus.

Background: FCER1A is the alpha subunit of the immunoglobulin epsilon receptor (IgE receptor). IgE receptor is a high affinity IgE receptor which plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. IgE receptor is comprised of an alpha subunit(FcERI), a beta subunit, and two gamma subunits. FcERI is glycosylated and contains 2 Ig-like (immunoglobulin-like) domains.

Product Categories/Family for FCER1A recombinant protein

Fc & Fc Receptor

NCBI and Uniprot Product Information

• NCBI GI #: 119865
• NCBI GeneID: 2205
• UniProt Accession #: P12319
• NCBI Official Full Name: High affinity immunoglobulin epsilon receptor subunit alpha
• NCBI Official Synonym Full Names: Fc fragment of IgE receptor Ia
• NCBI Official Symbol: FCER1A
• NCBI Official Synonym Symbols: FCE1A; FcERI
• NCBI Protein Information: high affinity immunoglobulin epsilon receptor subunit alpha
• UniProt Protein Name: High affinity immunoglobulin epsilon receptor subunit alpha
• Protein Family: High affinity immunoglobulin epsilon receptor
• UniProt Gene Name: FCER1A
• UniProt Synonym Gene Names: FCE1A; FcERI
• UniProt Entry Name: FCERA_HUMAN

NCBI Description

The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. [provided by RefSeq, Aug 2011]

Uniprot Description

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.