Fusion glycoprotein F0 Recombinant Protein | F recombinant protein

Recombinant Human respiratory syncytial virus B Fusion glycoprotein F0

Cat. Num. AAA1253087

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fusion glycoprotein F0; Recombinant Human respiratory syncytial virus B Fusion glycoprotein F0; F recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 137-574. Partial-length
• Sequence: FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for F recombinant protein

During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participates in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.

References

Respiratory syncytial virus (RSV)SH and G proteins are not essential for viral replication in vitro clinical evaluation and molecular characterization of a cold-passaged, attenuated RSV subgroup B mutant.Karron R.A., Buonagurio D.A., Georgiu A.F., Whitehead S.S., Adamus J.E., Clements-Mann M.L., Harris D.O., Randolph V.B., Udem S.A., Murphy B.R., Sidhu M.S.Proc. Natl. Acad. Sci. U.S.A. 94:13961-13966(1997) Fatty acid acylation of the fusion glycoprotein of human respiratory syncytial virus.Arumugham R.G., Seid R.C. Jr., Doyle S., Hildreth S.W., Paradisio P.R.J. Biol. Chem. 264:10339-10342(1989)

NCBI and Uniprot Product Information

• NCBI GI #: 9629206
• NCBI GeneID: 1489825
• NCBI Accession #: NP_056863.1
• NCBI GenBank Nucleotide #: NC_001781.1
• UniProt Accession #: O36634
• Molecular Weight: 50.1 kDa
• NCBI Official Full Name: fusion protein
• NCBI Official Symbol: F
• NCBI Protein Information: F
• UniProt Protein Name: Fusion glycoprotein F0
• Protein Family: Fusion glycoprotein
• UniProt Gene Name: F
• UniProt Synonym Gene Names: Protein F
• UniProt Entry Name: FUS_HRSVB

Uniprot Description

During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participates in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.