HERV-R_7q21.2 provirus ancestral Env polyprotein (ERV3-1) Recombinant Protein | ERV3-1 recombinant protein
Recombinant Human HERV-R_7q21.2 provirus ancestral Env polyprotein (ERV3-1)
Gene Names
ERV3-1; ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HERV-R_7q21.2 provirus ancestral Env polyprotein (ERV3-1); Recombinant Human HERV-R_7q21.2 provirus ancestral Env polyprotein (ERV3-1); ERV3-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
278-407. Partial
Sequence
QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ERV3-1 recombinant protein
The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,942 Da
NCBI Official Full Name
endogenous retrovirus group 3 member 1 Env polyprotein
NCBI Official Synonym Full Names
endogenous retrovirus group 3 member 1, envelope
NCBI Official Symbol
ERV3-1
NCBI Official Synonym Symbols
ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
NCBI Protein Information
endogenous retrovirus group 3 member 1 Env polyprotein
UniProt Protein Name
Endogenous retrovirus group 3 member 1 Env polyprotein
Protein Family
UniProt Gene Name
ERV3-1
UniProt Synonym Gene Names
ERV3; ERV3 envelope protein; ERV-R envelope protein; SU; TM
NCBI Description
This gene contains sequence derived from endogenous retrovirus, and is therefore similar to multiple other loci in the genome. Transcripts at this locus encode a conserved protein with a predicted signal peptide and similarity to the Env polyprotein. This protein is overexpressed in colorectal and other cancers. [provided by RefSeq, Jan 2017]
Uniprot Description
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro.
Research Articles on ERV3-1
Similar Products
Product Notes
The ERV3-1 erv3-1 (Catalog #AAA1299783) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 278-407. Partial. The amino acid sequence is listed below: QLAENIASSL HVASCYVCGG MNMGDQWPWE ARELMPQDNF TLTASSLEPA PSSQSIWFLK TSIIGKFCIA RWGKAFTDPV GELTCLGQQY YNETLGKTLW RGKSNNSESP HPSPFSRFPS LNHSWYQLEA. It is sometimes possible for the material contained within the vial of "HERV-R_7q21.2 provirus ancestral Env polyprotein (ERV3-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
