anti-Human ERV31 Polyclonal Antibody | anti-ERV31 antibody

Anti-ERV31 Antibody

Cat. Num. AAA178214

• Gene Names: ERV3-1; ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
• Reactivity: Human
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: ERV31; Polyclonal Antibody; Anti-ERV31 Antibody; Endogenous retrovirus group 3 member 1 Env polyprotein; Endogenous retroviral sequence 3; Endogenous retrovirus group 3 member 1; ENR1_HUMAN; Envelope polyprotein; envR; ERV R; ERV-3 envelope protein; ERV-R envelope protein; ERV3 1 envelope protein; ERV3; ERV3 envelope protein; ERV3-1; ERVR; FLJ23884; HERV R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; HERVR; SU; TM; Transmembrane protein; endogenous retrovirus group 3; member 1; anti-ERV31 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 604

• Applicable Applications for anti-ERV31 antibody: Western Blot (WB); ; Other applications have not been tested.
• Application Notes: Western Blot: 0.1-0.5ug/ml / Tested Species: Hu (In-house tested species with positive results.); ; Optimal dilutions should be determined by end users.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- ERV31 antibody, Western blotting)

Related Product Information for anti-ERV31 antibody

HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

References

1. Kato, N., Shimotohno, K., Van Leeuwen, D., Cohen, M. Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Kruppel. Molec. Cell. Biol. 10: 4401-4405, 1990.  2. Kim, H.-S., Crow, T. J., Hyun, B.-H. Assignment of the endogenous retrovirus HERV-R (ERV3) to human chromosome 7q11.2 by radiation hybrid mapping. Cytogenet. Cell Genet. 89: 10 only, 2000.  3. O'Connell C, O'Brien S, Nash WG, Cohen M (Dec 1984). "ERV3, a full-length human endogenous provirus: chromosomal localization and evolutionary relationships". Virology 138 (2): 225-35.

NCBI and Uniprot Product Information

• NCBI GI #: 145651814
• NCBI GeneID: 2086
• NCBI Accession #: NP_001007254.2
• NCBI GenBank Nucleotide #: NM_001007253.3
• UniProt Accession #: Q14264
• NCBI Official Full Name: endogenous retrovirus group 3 member 1 Env polyprotein
• NCBI Official Synonym Full Names: endogenous retrovirus group 3 member 1
• NCBI Official Symbol: ERV3-1
• NCBI Official Synonym Symbols: ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
• NCBI Protein Information: endogenous retrovirus group 3 member 1 Env polyprotein
• UniProt Protein Name: Endogenous retrovirus group 3 member 1 Env polyprotein
• UniProt Gene Name: ERV3-1
• UniProt Synonym Gene Names: ERV3; ERV3 envelope protein; ERV-R envelope protein; SU; TM
• UniProt Entry Name: ENR1_HUMAN

NCBI Description

The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma. [provided by RefSeq, Jul 2008]

Uniprot Description

ERV3: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. Belongs to the gamma type-C retroviral envelope protein family. HERV class-I R env subfamily.

Chromosomal Location of Human Ortholog: 7q11.2

Cellular Component: viral envelope