Endoplasmic reticulum resident protein 29 Recombinant Protein | ERP29 recombinant protein

Recombinant Human Endoplasmic reticulum resident protein 29

Cat. Num. AAA717149

• Gene Names: ERP29; ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Endoplasmic reticulum resident protein 29; Recombinant Human Endoplasmic reticulum resident protein 29; Endoplasmic reticulum resident protein 28; ERp28; Endoplasmic reticulum resident protein 31; ERp31; ERP29 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 40-251aa; Partial
• Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
• Sequence Length: 53

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ERP29 recombinant protein

Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Product Categories/Family for ERP29 recombinant protein

Signal Transduction

References

ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998) The WashU-Merck EST project.Hillier L., Clark N., Dubuque T., Elliston K., Hawkins M., Holman M., Hultman M., Kucaba T., Le M., Lennon G., Marra M., Parsons J., Rifkin L., Rohlfing T., Soares M., Tan F., Trevaskis E., Waterston R., Williamson A., Wohldmann P., Wilson R. Human liver protein map update 1993.Hughes G.J., Frutiger S., Paquet N., Pasquali C., Sanchez J.-C., Tissot J.-D., Bairoch A., Appel R.D., Hochstrasser D.F.Electrophoresis 14:1216-1222(1993) Human liver protein map a reference database established by microsequencing and gel comparison.Hochstrasser D.F., Frutiger S., Paquet N., Bairoch A., Ravier F., Pasquali C., Sanchez J.-C., Tissot J.-D., Bjellqvist B., Vargas R., Appel R.D., Hughes G.J.Electrophoresis 13:992-1001(1992) Lubec G., Vishwanath V.Submitted (MAR-2007) to UniProtKB Hubbard M.J.Submitted (DEC-1998) to UniProtKB Human ERp29 isolation, primary structural characterisation and two-dimensional gel mapping.Hubbard M.J., McHugh N.J.3.0.CO;2-2>Electrophoresis 21:3785-3796(2000) A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.Meunier L., Usherwood Y.-K., Chung K.T., Hendershot L.M.Mol. Biol. Cell 13:4456-4469(2002) Proteomic analysis of early melanosomes identification of novel melanosomal proteins.Basrur V., Yang F., Kushimoto T., Higashimoto Y., Yasumoto K., Valencia J., Muller J., Vieira W.D., Watabe H., Shabanowitz J., Hearing V.J., Hunt D.F., Appella E.J. Proteome Res. 2:69-79(2003) Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F.J. Proteome Res. 5:3135-3144(2006) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) A secreted tyrosine kinase acts in the extracellular environment.Bordoli M.R., Yum J., Breitkopf S.B., Thon J.N., Italiano J.E. Jr., Xiao J., Worby C., Wong S.K., Lin G., Edenius M., Keller T.L., Asara J.M., Dixon J.E., Yeo C.Y., Whitman M.Cell 158:1033-1044(2014) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 77628151
• NCBI GeneID: 10961
• NCBI Accession #: NP_001029197.1
• NCBI GenBank Nucleotide #: NM_001034025.1
• UniProt Accession #: P30040; Q3MJC3; Q6FHT4; C9J183
• Molecular Weight: 51.0 kDa
• NCBI Official Full Name: endoplasmic reticulum resident protein 29 isoform 2
• NCBI Official Synonym Full Names: endoplasmic reticulum protein 29
• NCBI Official Symbol: ERP29
• NCBI Official Synonym Symbols: ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107
• NCBI Protein Information: endoplasmic reticulum resident protein 29
• UniProt Protein Name: Endoplasmic reticulum resident protein 29
• Protein Family: Endoplasmic reticulum resident protein
• UniProt Gene Name: ERP29
• UniProt Synonym Gene Names: C12orf8; ERP28; ERp29; ERp28; ERp31
• UniProt Entry Name: ERP29_HUMAN

NCBI Description

This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

ERP29: Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: cell surface; endoplasmic reticulum; endoplasmic reticulum lumen; melanosome; membrane; smooth endoplasmic reticulum; transport vesicle

Molecular Function: chaperone binding; protein binding; protein disulfide isomerase activity; protein homodimerization activity

Biological Process: activation of MAPK activity; intracellular protein transport; negative regulation of protein secretion; positive regulation of protein amino acid phosphorylation; protein folding; protein secretion; protein unfolding