Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Endoplasmic reticulum resident protein 29 Recombinant Protein | ERP29 recombinant protein

Recombinant human Endoplasmic reticulum resident protein 29

Gene Names
ERP29; ERp28; ERp31; PDIA9; PDI-DB; C12orf8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoplasmic reticulum resident protein 29; Recombinant human Endoplasmic reticulum resident protein 29; Recombinant human Endoplasmic reticulum resident protein 29 protein; ERP29 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for ERP29 recombinant protein
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
References
[1] "ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 KD
NCBI Official Full Name
Homo sapiens endoplasmic reticulum protein 29 (ERP29), transcript variant 1, mRNA
NCBI Official Synonym Full Names
endoplasmic reticulum protein 29
NCBI Official Symbol
ERP29
NCBI Official Synonym Symbols
ERp28; ERp31; PDIA9; PDI-DB; C12orf8
NCBI Protein Information
endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9
UniProt Protein Name
Endoplasmic reticulum resident protein 29
UniProt Gene Name
ERP29
UniProt Synonym Gene Names
C12orf8; ERP28; ERp29; ERp28; ERp31
UniProt Entry Name
ERP29_HUMAN

NCBI Description

This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Subunit structure: Homodimer. Part a large chaperone multiprotein complex comprising CABP1, DNAJB11, HSP90B1, HSPA5, HYOU, PDIA2, PDIA4, PPIB, SDF2L1, UGT1A1 and very small amounts of ERP29, but not, or at very low levels, CALR nor CANX.

Subcellular location: Endoplasmic reticulum lumen. Melanosome. Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Ref.10 Ref.11

Tissue specificity: Ubiquitous. Mostly expressed in secretory tissues.

Research Articles on ERP29

Similar Products

Product Notes

The ERP29 erp29 (Catalog #AAA717186) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: PLDTVTFYKV IPKSKFVLVK FDTQYPYGEK QDEFKRLAEN SASSDDLLVA EVGISDYGDK LNMELSEKYK LDKESYPVFY LFRDGDFENP VPYTGAVKVG AIQRWLKGQG VYLGMPGCLP VYDALAGEFI RASGVEARQA LLKQGQDNLS SVKETQKKWA EQYLKIMGKI LDQGEDFPAS EMTRIARLIE KNKMSDGKKE ELQKSLNILT AF. It is sometimes possible for the material contained within the vial of "Endoplasmic reticulum resident protein 29, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.