Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: A2MPSample Tissue: Rat Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Rat A2M Polyclonal Antibody | anti-A2M antibody

A2M Antibody - middle region

Gene Names
A2m; A2mp
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
A2M; Polyclonal Antibody; A2M Antibody - middle region; anti-A2M antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGYQRQLNYKHRDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFID
Sequence Length
1472
Applicable Applications for anti-A2M antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat A2MP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: A2MPSample Tissue: Rat Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: A2MPSample Tissue: Rat Testis lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-A2M antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161 kDa
NCBI Official Full Name
alpha-2-macroglobulin-P
NCBI Official Synonym Full Names
alpha-2-macroglobulin
NCBI Official Symbol
A2m
NCBI Official Synonym Symbols
A2mp
NCBI Protein Information
alpha-2-macroglobulin-P
UniProt Protein Name
Alpha-2-macroglobulin
Protein Family
UniProt Gene Name
A2m
UniProt Synonym Gene Names
A2m1; Alpha-2-M

Uniprot Description

Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.

Research Articles on A2M

Similar Products

Product Notes

The A2M a2m (Catalog #AAA3223980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A2M Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's A2M can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the A2M a2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGYQRQLNYK HRDGSYSTFG DKPGRSHANT WLTAFVLKSF AQARRYIFID. It is sometimes possible for the material contained within the vial of "A2M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.