Interleukin-27 subunit beta (Ebi3) Recombinant Protein | Ebi3 recombinant protein

Recombinant Mouse Interleukin-27 subunit beta (Ebi3), Partial

Cat. Num. AAA7136928

• Gene Names: Ebi3; EBI-3; IL-27
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-27 subunit beta (Ebi3); Recombinant Mouse Interleukin-27 subunit beta (Ebi3); Partial; Ebi3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 21-227aa, Partial
• Sequence: TALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHK

• Species: Human
• Tag: N-terminal 6xHis-GST-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 7657052
• NCBI GeneID: 50498
• NCBI Accession #: NP_056581.1
• NCBI GenBank Nucleotide #: NM_015766.2
• UniProt Accession #: O35228
• Molecular Weight: 25,353 Da
• NCBI Official Full Name: interleukin-27 subunit beta
• NCBI Official Synonym Full Names: Epstein-Barr virus induced gene 3
• NCBI Official Symbol: Ebi3
• NCBI Official Synonym Symbols: EBI-3; IL-27
• NCBI Protein Information: interleukin-27 subunit beta; IL-27 subunit beta; IL-27B; epstein-Barr virus-induced gene 3 protein homolog
• UniProt Protein Name: Interleukin-27 subunit beta
• Protein Family: Interleukin
• UniProt Gene Name: Ebi3
• UniProt Synonym Gene Names: Il27b; IL-27 subunit beta; IL-27B
• UniProt Entry Name: IL27B_MOUSE

Uniprot Description

IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; interleukin-27 receptor binding; cytokine activity

Biological Process: cytokine and chemokine mediated signaling pathway